Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8A3Q4

Protein Details
Accession A0A1B8A3Q4   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-42RQDYVPTEWLHRKKRRRKSPIDPYGRRLTKBasic
93-117DSETTESEPPRRRQRQRTVLDLQKQHydrophilic
NLS Segment(s)
PositionSequence
24-32RKKRRRKSP
Subcellular Location(s) nucl 17, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR008906  HATC_C_dom  
IPR012337  RNaseH-like_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF05699  Dimer_Tnp_hAT  
Amino Acid Sequences MVVIATVAWMIQRQDYVPTEWLHRKKRRRKSPIDPYGRRLTKVVGNREKGDFWICYQCDNKKEISLYALVNSGTSGALRHLRKDHHILVGEVDSETTESEPPRRRQRQRTVLDLQKQAVERLAIPKSKAELFKDLLLRWIVDADIPFSAVEHTDFRKLLSSLNEELVDELFPRSGVTIRSWLEAEYRSQKELLRSKLAASLYKKHLTFDLWTSLQEYGLLGVTVHFTDALKRPQTSLLALRRLRGAHSGENIGSALREVLSDDSDRVFPGPEIEGPEREIRVGDAPLRFAAAQGSSPPASPPAAQSQRPQRNVGLPHKYRDSVIDLPGRPVGSINPPVALEDSSTEEVLEQGDGEEEGSQRQRREIWSNLPSKPEIAHADLRAIRGCITCAIYKLEKYVILLEDSPAYWTAMILHPAFKDKWIREYLPGEHANRIVDSFKRFFERDYNKLPTQPTPIQKKPKSSHLGAHSYLAQRPSPANRDEVKQYLEEPIYEDEAVEDPFEYWRQREKDFPRLARMAYDLLSIPSTACECERAFSLAKLLVGTQRHSLQDLTMEMLTCVKFWRRNPLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.25
4 0.27
5 0.28
6 0.34
7 0.42
8 0.51
9 0.56
10 0.63
11 0.7
12 0.77
13 0.86
14 0.9
15 0.91
16 0.92
17 0.93
18 0.94
19 0.94
20 0.95
21 0.91
22 0.87
23 0.86
24 0.79
25 0.7
26 0.6
27 0.54
28 0.5
29 0.52
30 0.56
31 0.54
32 0.56
33 0.58
34 0.6
35 0.56
36 0.51
37 0.47
38 0.37
39 0.31
40 0.35
41 0.32
42 0.34
43 0.38
44 0.42
45 0.43
46 0.44
47 0.42
48 0.38
49 0.4
50 0.36
51 0.34
52 0.31
53 0.27
54 0.26
55 0.25
56 0.2
57 0.18
58 0.16
59 0.13
60 0.1
61 0.09
62 0.08
63 0.09
64 0.17
65 0.18
66 0.23
67 0.28
68 0.33
69 0.39
70 0.46
71 0.47
72 0.46
73 0.47
74 0.43
75 0.4
76 0.37
77 0.31
78 0.23
79 0.19
80 0.12
81 0.1
82 0.1
83 0.08
84 0.09
85 0.1
86 0.19
87 0.27
88 0.35
89 0.46
90 0.57
91 0.66
92 0.74
93 0.83
94 0.86
95 0.84
96 0.85
97 0.83
98 0.82
99 0.79
100 0.73
101 0.63
102 0.57
103 0.51
104 0.43
105 0.35
106 0.27
107 0.21
108 0.23
109 0.27
110 0.25
111 0.25
112 0.27
113 0.28
114 0.32
115 0.34
116 0.32
117 0.33
118 0.32
119 0.37
120 0.38
121 0.35
122 0.34
123 0.3
124 0.27
125 0.21
126 0.19
127 0.14
128 0.11
129 0.11
130 0.09
131 0.08
132 0.08
133 0.08
134 0.07
135 0.08
136 0.07
137 0.08
138 0.1
139 0.12
140 0.15
141 0.15
142 0.16
143 0.19
144 0.19
145 0.21
146 0.22
147 0.25
148 0.23
149 0.25
150 0.25
151 0.21
152 0.21
153 0.19
154 0.14
155 0.1
156 0.09
157 0.07
158 0.06
159 0.06
160 0.06
161 0.08
162 0.09
163 0.1
164 0.15
165 0.16
166 0.18
167 0.18
168 0.18
169 0.19
170 0.18
171 0.21
172 0.23
173 0.24
174 0.24
175 0.25
176 0.27
177 0.32
178 0.38
179 0.39
180 0.36
181 0.35
182 0.35
183 0.38
184 0.37
185 0.35
186 0.32
187 0.34
188 0.35
189 0.39
190 0.38
191 0.34
192 0.34
193 0.3
194 0.29
195 0.25
196 0.24
197 0.2
198 0.2
199 0.21
200 0.19
201 0.17
202 0.15
203 0.12
204 0.07
205 0.06
206 0.06
207 0.04
208 0.04
209 0.05
210 0.05
211 0.05
212 0.05
213 0.04
214 0.08
215 0.12
216 0.17
217 0.19
218 0.19
219 0.2
220 0.22
221 0.24
222 0.23
223 0.26
224 0.27
225 0.33
226 0.33
227 0.33
228 0.33
229 0.33
230 0.31
231 0.28
232 0.26
233 0.2
234 0.21
235 0.22
236 0.2
237 0.2
238 0.18
239 0.14
240 0.11
241 0.07
242 0.06
243 0.04
244 0.04
245 0.04
246 0.05
247 0.06
248 0.06
249 0.07
250 0.08
251 0.08
252 0.08
253 0.08
254 0.08
255 0.06
256 0.07
257 0.07
258 0.07
259 0.12
260 0.13
261 0.13
262 0.14
263 0.16
264 0.14
265 0.14
266 0.13
267 0.09
268 0.09
269 0.1
270 0.11
271 0.1
272 0.1
273 0.1
274 0.11
275 0.1
276 0.09
277 0.09
278 0.06
279 0.06
280 0.06
281 0.08
282 0.08
283 0.08
284 0.08
285 0.08
286 0.09
287 0.09
288 0.1
289 0.17
290 0.21
291 0.23
292 0.28
293 0.37
294 0.45
295 0.47
296 0.47
297 0.4
298 0.42
299 0.47
300 0.5
301 0.5
302 0.44
303 0.44
304 0.45
305 0.44
306 0.38
307 0.34
308 0.31
309 0.24
310 0.26
311 0.29
312 0.26
313 0.27
314 0.28
315 0.26
316 0.2
317 0.17
318 0.15
319 0.13
320 0.16
321 0.15
322 0.14
323 0.14
324 0.15
325 0.15
326 0.14
327 0.1
328 0.08
329 0.11
330 0.11
331 0.11
332 0.1
333 0.09
334 0.09
335 0.09
336 0.08
337 0.04
338 0.03
339 0.04
340 0.04
341 0.04
342 0.05
343 0.05
344 0.07
345 0.11
346 0.14
347 0.14
348 0.16
349 0.19
350 0.22
351 0.28
352 0.31
353 0.35
354 0.4
355 0.46
356 0.47
357 0.47
358 0.43
359 0.38
360 0.34
361 0.3
362 0.24
363 0.22
364 0.24
365 0.21
366 0.26
367 0.26
368 0.27
369 0.24
370 0.21
371 0.18
372 0.15
373 0.15
374 0.12
375 0.13
376 0.13
377 0.14
378 0.17
379 0.18
380 0.18
381 0.19
382 0.18
383 0.16
384 0.16
385 0.18
386 0.15
387 0.15
388 0.15
389 0.14
390 0.13
391 0.12
392 0.12
393 0.1
394 0.09
395 0.07
396 0.07
397 0.09
398 0.09
399 0.12
400 0.12
401 0.13
402 0.14
403 0.18
404 0.18
405 0.2
406 0.26
407 0.24
408 0.3
409 0.34
410 0.35
411 0.37
412 0.41
413 0.41
414 0.41
415 0.45
416 0.4
417 0.37
418 0.37
419 0.32
420 0.28
421 0.26
422 0.21
423 0.19
424 0.22
425 0.22
426 0.23
427 0.27
428 0.28
429 0.29
430 0.36
431 0.41
432 0.42
433 0.47
434 0.53
435 0.49
436 0.53
437 0.54
438 0.48
439 0.48
440 0.49
441 0.5
442 0.52
443 0.59
444 0.66
445 0.68
446 0.74
447 0.71
448 0.74
449 0.73
450 0.67
451 0.66
452 0.63
453 0.65
454 0.56
455 0.53
456 0.48
457 0.43
458 0.42
459 0.37
460 0.3
461 0.25
462 0.28
463 0.32
464 0.33
465 0.32
466 0.36
467 0.36
468 0.4
469 0.43
470 0.43
471 0.39
472 0.34
473 0.34
474 0.33
475 0.31
476 0.27
477 0.24
478 0.22
479 0.22
480 0.2
481 0.19
482 0.14
483 0.15
484 0.15
485 0.12
486 0.1
487 0.08
488 0.1
489 0.13
490 0.14
491 0.16
492 0.24
493 0.28
494 0.31
495 0.4
496 0.46
497 0.53
498 0.61
499 0.63
500 0.63
501 0.63
502 0.61
503 0.53
504 0.49
505 0.41
506 0.32
507 0.28
508 0.2
509 0.18
510 0.18
511 0.15
512 0.13
513 0.12
514 0.12
515 0.12
516 0.12
517 0.14
518 0.14
519 0.16
520 0.18
521 0.2
522 0.21
523 0.21
524 0.24
525 0.22
526 0.23
527 0.21
528 0.21
529 0.22
530 0.23
531 0.25
532 0.26
533 0.28
534 0.29
535 0.3
536 0.29
537 0.24
538 0.26
539 0.24
540 0.23
541 0.2
542 0.19
543 0.17
544 0.2
545 0.19
546 0.15
547 0.18
548 0.22
549 0.28
550 0.31