Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8B0N4

Protein Details
Accession A0A1B8B0N4    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
170-211IYLARIQTQNAKRRRRERKRRRRERRERRRARKRLEMILGPEBasic
NLS Segment(s)
PositionSequence
180-203AKRRRRERKRRRRERRERRRARKR
Subcellular Location(s) nucl 16, cyto 7, mito 2
Family & Domain DBs
Amino Acid Sequences MPTRPGSLVSETTMHNVEDRMDEEPDGCCEEGTCWETTHEQKGDERYHPLQFTLQLRPKQIVTDFDTKPEDIDEKATSEQDAKERSETTELTQSSSTATTTETNDICSYTEQKAEAYREIENCLGMPEEMKKNVLEMLEQEDWEGISAFLEQRARWRRKADATVQRWRDIYLARIQTQNAKRRRRERKRRRRERRERRRARKRLEMILGPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.18
3 0.17
4 0.16
5 0.16
6 0.16
7 0.16
8 0.16
9 0.16
10 0.15
11 0.16
12 0.16
13 0.17
14 0.15
15 0.12
16 0.12
17 0.12
18 0.16
19 0.18
20 0.17
21 0.15
22 0.17
23 0.21
24 0.24
25 0.3
26 0.27
27 0.27
28 0.29
29 0.36
30 0.39
31 0.38
32 0.41
33 0.37
34 0.4
35 0.39
36 0.36
37 0.31
38 0.31
39 0.32
40 0.35
41 0.39
42 0.38
43 0.39
44 0.4
45 0.38
46 0.36
47 0.34
48 0.3
49 0.28
50 0.33
51 0.31
52 0.33
53 0.34
54 0.31
55 0.29
56 0.25
57 0.21
58 0.13
59 0.16
60 0.13
61 0.13
62 0.14
63 0.14
64 0.13
65 0.14
66 0.15
67 0.16
68 0.17
69 0.16
70 0.17
71 0.18
72 0.19
73 0.2
74 0.19
75 0.17
76 0.21
77 0.2
78 0.2
79 0.19
80 0.18
81 0.16
82 0.16
83 0.13
84 0.07
85 0.09
86 0.08
87 0.09
88 0.12
89 0.11
90 0.12
91 0.12
92 0.12
93 0.11
94 0.11
95 0.12
96 0.11
97 0.12
98 0.11
99 0.11
100 0.14
101 0.15
102 0.16
103 0.15
104 0.16
105 0.16
106 0.18
107 0.17
108 0.14
109 0.12
110 0.11
111 0.09
112 0.07
113 0.07
114 0.09
115 0.11
116 0.12
117 0.13
118 0.13
119 0.13
120 0.14
121 0.14
122 0.1
123 0.09
124 0.15
125 0.14
126 0.14
127 0.14
128 0.12
129 0.12
130 0.12
131 0.11
132 0.05
133 0.04
134 0.05
135 0.05
136 0.08
137 0.09
138 0.09
139 0.18
140 0.28
141 0.33
142 0.38
143 0.42
144 0.46
145 0.53
146 0.61
147 0.61
148 0.62
149 0.65
150 0.7
151 0.69
152 0.66
153 0.58
154 0.52
155 0.44
156 0.35
157 0.31
158 0.3
159 0.31
160 0.3
161 0.32
162 0.33
163 0.39
164 0.46
165 0.51
166 0.52
167 0.57
168 0.64
169 0.73
170 0.83
171 0.85
172 0.88
173 0.91
174 0.93
175 0.95
176 0.97
177 0.98
178 0.98
179 0.98
180 0.98
181 0.98
182 0.98
183 0.98
184 0.98
185 0.97
186 0.97
187 0.94
188 0.94
189 0.91
190 0.89
191 0.86