Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8A3B2

Protein Details
Accession A0A1B8A3B2   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
65-88RDSPTKRKWVCKHCLRKAKPKMTDBasic
NLS Segment(s)
PositionSequence
112-121GRRKPPALWK
Subcellular Location(s) nucl 14, cyto 7, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003656  Znf_BED  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
PROSITE View protein in PROSITE  
PS50808  ZF_BED  
Amino Acid Sequences MDANVPVKCQSPDCSAPSASPNNLDASPGDWKAFPWHKFPGFSISEHVGRQTSWVWQHGFDIQARDSPTKRKWVCKHCLRKAKPKMTDFSAVGTQNIEKHLFREHGLVDKSGRRKPPALWKGKQEKTPSRNIVEMLNLDTSDPKEQAIANALIQRFDRDHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.35
4 0.39
5 0.39
6 0.33
7 0.3
8 0.28
9 0.27
10 0.26
11 0.25
12 0.19
13 0.17
14 0.2
15 0.19
16 0.18
17 0.15
18 0.16
19 0.24
20 0.31
21 0.3
22 0.31
23 0.37
24 0.39
25 0.41
26 0.41
27 0.4
28 0.34
29 0.33
30 0.32
31 0.28
32 0.27
33 0.26
34 0.25
35 0.19
36 0.16
37 0.17
38 0.14
39 0.15
40 0.15
41 0.19
42 0.18
43 0.18
44 0.2
45 0.19
46 0.2
47 0.17
48 0.17
49 0.14
50 0.16
51 0.18
52 0.19
53 0.19
54 0.24
55 0.25
56 0.33
57 0.35
58 0.42
59 0.49
60 0.56
61 0.64
62 0.68
63 0.76
64 0.75
65 0.83
66 0.79
67 0.82
68 0.82
69 0.82
70 0.79
71 0.72
72 0.66
73 0.59
74 0.58
75 0.47
76 0.4
77 0.34
78 0.27
79 0.23
80 0.2
81 0.17
82 0.13
83 0.15
84 0.14
85 0.1
86 0.11
87 0.15
88 0.15
89 0.16
90 0.17
91 0.16
92 0.2
93 0.21
94 0.22
95 0.21
96 0.26
97 0.31
98 0.33
99 0.37
100 0.35
101 0.37
102 0.41
103 0.5
104 0.54
105 0.58
106 0.57
107 0.63
108 0.69
109 0.73
110 0.73
111 0.71
112 0.71
113 0.67
114 0.73
115 0.69
116 0.62
117 0.58
118 0.53
119 0.45
120 0.39
121 0.34
122 0.27
123 0.22
124 0.18
125 0.16
126 0.17
127 0.17
128 0.17
129 0.16
130 0.14
131 0.14
132 0.15
133 0.16
134 0.19
135 0.19
136 0.18
137 0.23
138 0.23
139 0.24
140 0.24
141 0.25