Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8ASX3

Protein Details
Accession A0A1B8ASX3    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MGGPPKFCVPRRLRRLFKKRKESSRDVELRBasic
68-91PPPWDGRRPSLKHKKRTMFSPKGFBasic
NLS Segment(s)
PositionSequence
11-21RRLRRLFKKRK
74-83RRPSLKHKKR
Subcellular Location(s) nucl 12.5, mito_nucl 10.833, cyto_nucl 10.666, cyto 7.5, mito 7
Family & Domain DBs
Amino Acid Sequences MGGPPKFCVPRRLRRLFKKRKESSRDVELRVISRPFNVYRIDSKGEGGEIARATGNRCHSISPLPPPPPPWDGRRPSLKHKKRTMFSPKGFYPPKTWRYASH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.89
3 0.9
4 0.92
5 0.92
6 0.92
7 0.92
8 0.91
9 0.88
10 0.84
11 0.83
12 0.79
13 0.71
14 0.65
15 0.57
16 0.49
17 0.44
18 0.38
19 0.28
20 0.23
21 0.23
22 0.19
23 0.2
24 0.2
25 0.19
26 0.21
27 0.25
28 0.26
29 0.23
30 0.22
31 0.2
32 0.18
33 0.15
34 0.12
35 0.1
36 0.07
37 0.07
38 0.07
39 0.07
40 0.08
41 0.11
42 0.14
43 0.14
44 0.15
45 0.15
46 0.16
47 0.2
48 0.21
49 0.25
50 0.29
51 0.3
52 0.3
53 0.32
54 0.35
55 0.36
56 0.37
57 0.36
58 0.39
59 0.41
60 0.46
61 0.54
62 0.55
63 0.61
64 0.69
65 0.72
66 0.73
67 0.79
68 0.82
69 0.77
70 0.82
71 0.82
72 0.81
73 0.79
74 0.77
75 0.7
76 0.7
77 0.71
78 0.63
79 0.61
80 0.6
81 0.6
82 0.59