Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8AU48

Protein Details
Accession A0A1B8AU48    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
161-185GSVVDEGKDKNKKKQKKGKKSKSKNBasic
NLS Segment(s)
PositionSequence
166-185EGKDKNKKKQKKGKKSKSKN
Subcellular Location(s) nucl 18.5, cyto_nucl 13.833, mito_nucl 10.166, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR011082  Exosome-assoc_fac/DNA_repair  
IPR007146  Sas10/Utp3/C1D  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MTDVKDITPDLDRLDDQLDDLEETLQPLLGNLEGMASELPLLDKAKLFSLTAYAIESLLFSSLKLEGSDTQTQAVLDEIKRIQQYFGKIKNIEAPEAEESRNLTVNQEAAARILKADLADNKTISNKLAEKIAEERAKALLKSVENRKRPAEESPVPSKPGSVVDEGKDKNKKKQKKGKKSKSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.15
4 0.15
5 0.14
6 0.12
7 0.12
8 0.11
9 0.09
10 0.1
11 0.09
12 0.08
13 0.07
14 0.07
15 0.07
16 0.06
17 0.06
18 0.05
19 0.05
20 0.05
21 0.06
22 0.05
23 0.04
24 0.04
25 0.04
26 0.05
27 0.06
28 0.07
29 0.08
30 0.09
31 0.1
32 0.12
33 0.13
34 0.13
35 0.11
36 0.12
37 0.12
38 0.12
39 0.12
40 0.1
41 0.09
42 0.08
43 0.08
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.06
50 0.07
51 0.07
52 0.08
53 0.09
54 0.14
55 0.17
56 0.17
57 0.17
58 0.16
59 0.16
60 0.15
61 0.14
62 0.1
63 0.08
64 0.1
65 0.1
66 0.12
67 0.13
68 0.13
69 0.14
70 0.15
71 0.2
72 0.25
73 0.29
74 0.32
75 0.31
76 0.31
77 0.37
78 0.35
79 0.3
80 0.23
81 0.2
82 0.18
83 0.19
84 0.18
85 0.13
86 0.12
87 0.13
88 0.14
89 0.12
90 0.1
91 0.09
92 0.09
93 0.09
94 0.09
95 0.09
96 0.07
97 0.08
98 0.07
99 0.07
100 0.07
101 0.06
102 0.06
103 0.08
104 0.11
105 0.14
106 0.16
107 0.16
108 0.17
109 0.18
110 0.18
111 0.17
112 0.17
113 0.15
114 0.15
115 0.18
116 0.17
117 0.18
118 0.2
119 0.27
120 0.26
121 0.24
122 0.25
123 0.25
124 0.27
125 0.24
126 0.24
127 0.21
128 0.21
129 0.29
130 0.38
131 0.44
132 0.48
133 0.52
134 0.54
135 0.54
136 0.53
137 0.52
138 0.51
139 0.49
140 0.5
141 0.54
142 0.53
143 0.51
144 0.49
145 0.43
146 0.35
147 0.32
148 0.28
149 0.25
150 0.25
151 0.25
152 0.34
153 0.35
154 0.42
155 0.47
156 0.48
157 0.54
158 0.62
159 0.69
160 0.72
161 0.81
162 0.84
163 0.87
164 0.94
165 0.95