Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8AFF4

Protein Details
Accession A0A1B8AFF4   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
128-162EDENKRREEKRSENEKKEAKRKAWKEAQQKHESNTBasic
NLS Segment(s)
PositionSequence
114-152KKAAKDERRAARRQEDENKRREEKRSENEKKEAKRKAWK
Subcellular Location(s) mito 12.5, nucl 10.5, cyto_mito 8.333, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
Amino Acid Sequences MSSPVAKAARRVTTELRGVVVSAGLMEKTVKVRVGGQKWNKTVNKWFADPKHYLVHDPNSSLRTGDVVSIAPGWPTSQHKRHVIKEIIAPYGVPTSERPPVPTLEERIADYEAKKAAKDERRAARRQEDENKRREEKRSENEKKEAKRKAWKEAQQKHESNTSTNDVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.44
3 0.39
4 0.32
5 0.29
6 0.25
7 0.19
8 0.12
9 0.08
10 0.07
11 0.05
12 0.06
13 0.06
14 0.07
15 0.09
16 0.12
17 0.12
18 0.12
19 0.19
20 0.27
21 0.33
22 0.41
23 0.48
24 0.55
25 0.57
26 0.66
27 0.62
28 0.58
29 0.61
30 0.6
31 0.55
32 0.5
33 0.54
34 0.49
35 0.52
36 0.5
37 0.45
38 0.42
39 0.38
40 0.37
41 0.34
42 0.36
43 0.32
44 0.31
45 0.3
46 0.25
47 0.25
48 0.22
49 0.18
50 0.13
51 0.12
52 0.1
53 0.08
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.05
61 0.07
62 0.12
63 0.19
64 0.23
65 0.28
66 0.37
67 0.42
68 0.46
69 0.52
70 0.48
71 0.44
72 0.43
73 0.41
74 0.33
75 0.27
76 0.24
77 0.16
78 0.15
79 0.12
80 0.09
81 0.08
82 0.1
83 0.14
84 0.15
85 0.16
86 0.17
87 0.18
88 0.22
89 0.24
90 0.24
91 0.23
92 0.23
93 0.22
94 0.22
95 0.22
96 0.19
97 0.17
98 0.16
99 0.16
100 0.16
101 0.15
102 0.16
103 0.23
104 0.3
105 0.36
106 0.42
107 0.49
108 0.56
109 0.61
110 0.65
111 0.66
112 0.64
113 0.66
114 0.67
115 0.69
116 0.69
117 0.73
118 0.74
119 0.72
120 0.71
121 0.7
122 0.69
123 0.68
124 0.7
125 0.74
126 0.76
127 0.77
128 0.81
129 0.83
130 0.83
131 0.82
132 0.8
133 0.78
134 0.79
135 0.77
136 0.79
137 0.8
138 0.8
139 0.82
140 0.83
141 0.84
142 0.83
143 0.81
144 0.75
145 0.72
146 0.65
147 0.57
148 0.53