Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8A5J7

Protein Details
Accession A0A1B8A5J7   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
81-100RLSRGKKRKAVPNPNKKFMTHydrophilic
NLS Segment(s)
PositionSequence
84-92RGKKRKAVP
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MHPEIQPDKKETTPGSDGHRDGQVDSDNTPKTSRHIRDLGKNKSPSTRRRYSVISKGFEAQESKIASLSTRIASLEEEVGRLSRGKKRKAVPNPNKKFMTLAEALAAGDTISEPNEAIEGAGVVEDVIEVGGMEEDERSYSGKEELGVVRTRTGREVKRPRKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.43
4 0.43
5 0.4
6 0.42
7 0.35
8 0.31
9 0.31
10 0.28
11 0.23
12 0.23
13 0.26
14 0.24
15 0.25
16 0.26
17 0.23
18 0.24
19 0.32
20 0.35
21 0.36
22 0.42
23 0.46
24 0.55
25 0.64
26 0.68
27 0.67
28 0.67
29 0.62
30 0.63
31 0.65
32 0.64
33 0.63
34 0.63
35 0.57
36 0.57
37 0.62
38 0.6
39 0.62
40 0.6
41 0.54
42 0.47
43 0.48
44 0.44
45 0.39
46 0.33
47 0.24
48 0.21
49 0.19
50 0.17
51 0.15
52 0.14
53 0.13
54 0.13
55 0.14
56 0.09
57 0.09
58 0.09
59 0.08
60 0.09
61 0.09
62 0.09
63 0.08
64 0.08
65 0.07
66 0.07
67 0.07
68 0.08
69 0.1
70 0.15
71 0.22
72 0.27
73 0.33
74 0.4
75 0.49
76 0.59
77 0.68
78 0.72
79 0.77
80 0.8
81 0.81
82 0.75
83 0.66
84 0.56
85 0.46
86 0.41
87 0.31
88 0.23
89 0.16
90 0.15
91 0.14
92 0.12
93 0.12
94 0.05
95 0.04
96 0.04
97 0.03
98 0.04
99 0.04
100 0.04
101 0.04
102 0.05
103 0.04
104 0.04
105 0.04
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.03
119 0.03
120 0.03
121 0.04
122 0.04
123 0.05
124 0.06
125 0.07
126 0.08
127 0.09
128 0.1
129 0.11
130 0.11
131 0.15
132 0.17
133 0.2
134 0.24
135 0.23
136 0.27
137 0.29
138 0.3
139 0.32
140 0.38
141 0.41
142 0.48
143 0.58