Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8B0E4

Protein Details
Accession A0A1B8B0E4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKSAPGRIPRPRPPRFHRNKVFVVFHydrophilic
NLS Segment(s)
PositionSequence
10-12RPR
Subcellular Location(s) mito 12, E.R. 7, plas 4, cyto 1, extr 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKSAPGRIPRPRPPRFHRNKVFVVFEELLHHLYLGAQKANLGSELFILRLVVLVMVCICGLIRVLFSHGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.86
4 0.85
5 0.82
6 0.81
7 0.76
8 0.71
9 0.6
10 0.57
11 0.46
12 0.37
13 0.32
14 0.25
15 0.21
16 0.17
17 0.16
18 0.09
19 0.09
20 0.1
21 0.09
22 0.08
23 0.07
24 0.07
25 0.07
26 0.08
27 0.08
28 0.06
29 0.05
30 0.06
31 0.07
32 0.06
33 0.06
34 0.06
35 0.05
36 0.05
37 0.05
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.06
50 0.06
51 0.1