Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YJZ5

Protein Details
Accession C7YJZ5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
37-64NNSPPPSSSRPRPRPRPRRTQLDKIERCHydrophilic
NLS Segment(s)
PositionSequence
46-55RPRPRPRPRR
Subcellular Location(s) nucl 12, extr 6, mito 5, cyto 3
Family & Domain DBs
KEGG nhe:NECHADRAFT_103043  -  
Amino Acid Sequences MTLLAAPAATLILPPCCRFACIAELCCPPPALHPQPNNSPPPSSSRPRPRPRPRRTQLDKIERCSLRPSSSHSACDPTTDVAFLTLKQPAPLRASLPPPRVRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.18
4 0.19
5 0.2
6 0.21
7 0.24
8 0.27
9 0.29
10 0.3
11 0.32
12 0.33
13 0.32
14 0.3
15 0.23
16 0.21
17 0.27
18 0.29
19 0.34
20 0.37
21 0.41
22 0.48
23 0.53
24 0.54
25 0.47
26 0.41
27 0.35
28 0.38
29 0.39
30 0.36
31 0.4
32 0.47
33 0.56
34 0.64
35 0.74
36 0.78
37 0.83
38 0.86
39 0.88
40 0.84
41 0.85
42 0.83
43 0.82
44 0.81
45 0.81
46 0.78
47 0.72
48 0.73
49 0.63
50 0.57
51 0.51
52 0.44
53 0.35
54 0.32
55 0.34
56 0.35
57 0.37
58 0.38
59 0.35
60 0.36
61 0.33
62 0.34
63 0.28
64 0.21
65 0.19
66 0.17
67 0.15
68 0.13
69 0.13
70 0.12
71 0.12
72 0.14
73 0.14
74 0.16
75 0.19
76 0.21
77 0.24
78 0.26
79 0.27
80 0.28
81 0.36
82 0.43
83 0.49