Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8G811

Protein Details
Accession A0A1B8G811   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
58-84AEKAEKSERVSKRPKKATAKVRLSRGEHydrophilic
NLS Segment(s)
PositionSequence
58-126AEKAEKSERVSKRPKKATAKVRLSRGEDVKVSSADAKPRNVSARGREKMEKLRKERAVRRGKKATPHQQ
136-145EAGHRSRRKR
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAQPAQSESEIPTAEPPNSRPKDVLRLVCGWNEKTNTYLYRDEVVNPPPIYGNGPQKAEKAEKSERVSKRPKKATAKVRLSRGEDVKVSSADAKPRNVSARGREKMEKLRKERAVRRGKKATPHQQPSPASTPASEAGHRSRRKRAPSQSVNSESSDSDDDSSDEVPPDKRLYAVPDHLQGTVRPVPRPENSGEMPWTDMEITTVPLPEDPAVKIGGFDNIMVTLVSPENGKPHNEPAKVLDCRLHPDGTYFLLVSWWFERRALSKNLVGFKRYLDRRWPADAPFKFVLGCHFDVITNDAITEKMEDDERFCNSMVYGGVTHNCELFSDVPDEMERRECLKKGAKGDARLVEERKQKSLFRMLLRPEMSGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.29
4 0.35
5 0.39
6 0.41
7 0.39
8 0.42
9 0.49
10 0.53
11 0.56
12 0.5
13 0.52
14 0.52
15 0.54
16 0.54
17 0.47
18 0.45
19 0.42
20 0.37
21 0.34
22 0.37
23 0.34
24 0.34
25 0.34
26 0.3
27 0.31
28 0.32
29 0.33
30 0.33
31 0.33
32 0.35
33 0.32
34 0.31
35 0.28
36 0.27
37 0.28
38 0.29
39 0.34
40 0.32
41 0.36
42 0.37
43 0.38
44 0.42
45 0.44
46 0.41
47 0.4
48 0.43
49 0.47
50 0.51
51 0.59
52 0.6
53 0.64
54 0.72
55 0.73
56 0.76
57 0.77
58 0.81
59 0.82
60 0.85
61 0.86
62 0.86
63 0.88
64 0.84
65 0.83
66 0.8
67 0.74
68 0.72
69 0.65
70 0.58
71 0.49
72 0.44
73 0.38
74 0.32
75 0.28
76 0.24
77 0.23
78 0.26
79 0.28
80 0.29
81 0.28
82 0.32
83 0.35
84 0.36
85 0.38
86 0.4
87 0.47
88 0.47
89 0.51
90 0.52
91 0.53
92 0.59
93 0.64
94 0.64
95 0.6
96 0.66
97 0.69
98 0.74
99 0.77
100 0.77
101 0.78
102 0.77
103 0.8
104 0.8
105 0.76
106 0.76
107 0.78
108 0.78
109 0.77
110 0.77
111 0.72
112 0.7
113 0.68
114 0.64
115 0.59
116 0.5
117 0.4
118 0.33
119 0.3
120 0.25
121 0.24
122 0.19
123 0.17
124 0.22
125 0.3
126 0.35
127 0.37
128 0.45
129 0.5
130 0.57
131 0.64
132 0.67
133 0.69
134 0.73
135 0.76
136 0.75
137 0.73
138 0.67
139 0.59
140 0.5
141 0.39
142 0.32
143 0.26
144 0.18
145 0.13
146 0.11
147 0.1
148 0.1
149 0.11
150 0.09
151 0.08
152 0.09
153 0.09
154 0.1
155 0.11
156 0.1
157 0.1
158 0.11
159 0.14
160 0.16
161 0.18
162 0.19
163 0.2
164 0.21
165 0.21
166 0.21
167 0.17
168 0.19
169 0.21
170 0.21
171 0.19
172 0.19
173 0.23
174 0.24
175 0.27
176 0.23
177 0.23
178 0.22
179 0.23
180 0.22
181 0.18
182 0.18
183 0.15
184 0.14
185 0.09
186 0.08
187 0.07
188 0.06
189 0.07
190 0.06
191 0.06
192 0.06
193 0.06
194 0.07
195 0.07
196 0.08
197 0.07
198 0.08
199 0.08
200 0.08
201 0.08
202 0.08
203 0.09
204 0.08
205 0.07
206 0.06
207 0.06
208 0.06
209 0.05
210 0.05
211 0.05
212 0.05
213 0.05
214 0.06
215 0.06
216 0.09
217 0.11
218 0.13
219 0.14
220 0.23
221 0.3
222 0.31
223 0.31
224 0.32
225 0.39
226 0.38
227 0.37
228 0.33
229 0.26
230 0.3
231 0.32
232 0.28
233 0.2
234 0.2
235 0.21
236 0.19
237 0.18
238 0.13
239 0.1
240 0.11
241 0.11
242 0.11
243 0.11
244 0.12
245 0.11
246 0.12
247 0.14
248 0.16
249 0.22
250 0.25
251 0.26
252 0.28
253 0.32
254 0.39
255 0.39
256 0.38
257 0.33
258 0.31
259 0.37
260 0.38
261 0.37
262 0.38
263 0.43
264 0.46
265 0.51
266 0.51
267 0.47
268 0.53
269 0.5
270 0.48
271 0.42
272 0.38
273 0.32
274 0.29
275 0.29
276 0.24
277 0.25
278 0.18
279 0.18
280 0.18
281 0.18
282 0.21
283 0.18
284 0.12
285 0.11
286 0.1
287 0.1
288 0.1
289 0.1
290 0.09
291 0.08
292 0.11
293 0.12
294 0.15
295 0.18
296 0.2
297 0.21
298 0.2
299 0.19
300 0.16
301 0.18
302 0.15
303 0.14
304 0.13
305 0.13
306 0.16
307 0.17
308 0.18
309 0.16
310 0.16
311 0.14
312 0.16
313 0.15
314 0.14
315 0.15
316 0.14
317 0.15
318 0.17
319 0.18
320 0.17
321 0.2
322 0.19
323 0.21
324 0.27
325 0.27
326 0.33
327 0.41
328 0.46
329 0.48
330 0.57
331 0.59
332 0.6
333 0.66
334 0.65
335 0.62
336 0.62
337 0.59
338 0.57
339 0.58
340 0.57
341 0.56
342 0.54
343 0.51
344 0.52
345 0.58
346 0.57
347 0.56
348 0.6
349 0.59
350 0.64
351 0.61