Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8GDG8

Protein Details
Accession A0A1B8GDG8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
52-72AKGGVYKKPARYKGKGKGARLBasic
NLS Segment(s)
PositionSequence
58-70KKPARYKGKGKGA
Subcellular Location(s) mito 11, cyto_nucl 8, nucl 7.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MGGIGPLQNHEGKMESVTLASRIRAHDEMIAAILEGETRGDGSSGLMDQQNAKGGVYKKPARYKGKGKGARLAIMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.12
3 0.11
4 0.11
5 0.13
6 0.12
7 0.13
8 0.14
9 0.14
10 0.19
11 0.19
12 0.19
13 0.18
14 0.17
15 0.16
16 0.14
17 0.13
18 0.08
19 0.07
20 0.06
21 0.04
22 0.03
23 0.03
24 0.02
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.04
31 0.04
32 0.05
33 0.06
34 0.06
35 0.07
36 0.08
37 0.11
38 0.11
39 0.11
40 0.15
41 0.17
42 0.22
43 0.3
44 0.36
45 0.41
46 0.5
47 0.59
48 0.63
49 0.7
50 0.74
51 0.76
52 0.81
53 0.81
54 0.76
55 0.75
56 0.71