Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8GB14

Protein Details
Accession A0A1B8GB14    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
48-74VDLVNPKTGKRKRKKVRRYDRLPALVRBasic
NLS Segment(s)
PositionSequence
54-65KTGKRKRKKVRR
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MDAAPASPSKPEPLHHPHNHYWKTTKKGRIIENWVLTKDSEGKTVRNVDLVNPKTGKRKRKKVRRYDRLPALVRIASGGARMERGDVEEDEEGEGEGKKRKKQCVVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.57
4 0.59
5 0.68
6 0.7
7 0.66
8 0.65
9 0.62
10 0.64
11 0.64
12 0.64
13 0.61
14 0.64
15 0.66
16 0.66
17 0.67
18 0.66
19 0.64
20 0.59
21 0.52
22 0.46
23 0.4
24 0.33
25 0.29
26 0.23
27 0.22
28 0.2
29 0.2
30 0.23
31 0.27
32 0.26
33 0.23
34 0.22
35 0.2
36 0.28
37 0.28
38 0.28
39 0.26
40 0.27
41 0.34
42 0.4
43 0.47
44 0.48
45 0.58
46 0.65
47 0.75
48 0.84
49 0.86
50 0.92
51 0.92
52 0.91
53 0.9
54 0.88
55 0.86
56 0.78
57 0.69
58 0.61
59 0.5
60 0.41
61 0.32
62 0.23
63 0.14
64 0.12
65 0.11
66 0.08
67 0.08
68 0.09
69 0.09
70 0.09
71 0.1
72 0.12
73 0.11
74 0.14
75 0.14
76 0.14
77 0.14
78 0.14
79 0.12
80 0.1
81 0.11
82 0.11
83 0.18
84 0.23
85 0.3
86 0.37
87 0.46