Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C7ZRA5

Protein Details
Accession C7ZRA5    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
10-34AWAETSAKARKRREKMEREKPGWKEBasic
NLS Segment(s)
PositionSequence
17-30KARKRREKMEREKP
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
KEGG nhe:NECHADRAFT_89473  -  
Amino Acid Sequences MGTEGNMISAWAETSAKARKRREKMEREKPGWKEWDLYCHMHDLADQISSMRQADKGIIPGNHGVFESAADIKAFRKANERYQRGRFGPKNTESVSHPHSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.21
3 0.28
4 0.36
5 0.45
6 0.54
7 0.62
8 0.73
9 0.78
10 0.81
11 0.85
12 0.88
13 0.9
14 0.86
15 0.85
16 0.78
17 0.74
18 0.68
19 0.58
20 0.52
21 0.42
22 0.43
23 0.38
24 0.37
25 0.3
26 0.28
27 0.26
28 0.21
29 0.2
30 0.14
31 0.11
32 0.09
33 0.08
34 0.06
35 0.06
36 0.07
37 0.07
38 0.06
39 0.06
40 0.06
41 0.07
42 0.08
43 0.1
44 0.13
45 0.13
46 0.14
47 0.16
48 0.16
49 0.15
50 0.14
51 0.12
52 0.09
53 0.09
54 0.09
55 0.07
56 0.07
57 0.07
58 0.07
59 0.08
60 0.14
61 0.15
62 0.15
63 0.23
64 0.27
65 0.38
66 0.48
67 0.55
68 0.56
69 0.62
70 0.7
71 0.66
72 0.72
73 0.68
74 0.65
75 0.68
76 0.64
77 0.64
78 0.57
79 0.56
80 0.48
81 0.49