Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8GTR4

Protein Details
Accession A0A1B8GTR4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
32-53LSTTTSSKPPHQPSKQKPTAPTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 4, E.R. 3, cyto 1, extr 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR021100  N-glycosylation_EOS1  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0034599  P:cellular response to oxidative stress  
Pfam View protein in Pfam  
PF12326  EOS1  
Amino Acid Sequences MPFPSRPSPPITQPPTTPTPPYSNHAAAGLPLSTTTSSKPPHQPSKQKPTAPTSRQDPRQDTRRRSVLHPSIAVLLGVNTHWHIPLLICRGLSTLPAAWWGLRCLLTFVGEVMVEGEEGEGGVWSVERRFRVTEVFLALLWCGASAYLSFFFTDCLMSRWLVHYTPQATLVRLLTINSINAYITSWVLYLSGGSEDPRQLLPAWISIASTLTVAYHTTQRHINIRRETRETISIFSLASFASMALLLIQLHLSRVNTMPVPPIFQLLGRAWEVGKKVVRRTGLGPVGREL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.58
3 0.56
4 0.51
5 0.45
6 0.45
7 0.45
8 0.46
9 0.47
10 0.42
11 0.39
12 0.36
13 0.31
14 0.25
15 0.23
16 0.19
17 0.11
18 0.1
19 0.1
20 0.1
21 0.11
22 0.13
23 0.17
24 0.21
25 0.28
26 0.37
27 0.45
28 0.54
29 0.63
30 0.72
31 0.76
32 0.84
33 0.86
34 0.83
35 0.79
36 0.77
37 0.78
38 0.72
39 0.69
40 0.66
41 0.66
42 0.69
43 0.71
44 0.7
45 0.67
46 0.72
47 0.75
48 0.74
49 0.73
50 0.73
51 0.68
52 0.64
53 0.67
54 0.64
55 0.6
56 0.54
57 0.46
58 0.4
59 0.36
60 0.32
61 0.21
62 0.13
63 0.08
64 0.07
65 0.07
66 0.06
67 0.06
68 0.06
69 0.06
70 0.07
71 0.07
72 0.11
73 0.15
74 0.16
75 0.15
76 0.15
77 0.16
78 0.16
79 0.16
80 0.13
81 0.09
82 0.08
83 0.09
84 0.09
85 0.09
86 0.09
87 0.1
88 0.1
89 0.1
90 0.1
91 0.11
92 0.11
93 0.11
94 0.11
95 0.1
96 0.08
97 0.07
98 0.07
99 0.06
100 0.06
101 0.04
102 0.04
103 0.04
104 0.03
105 0.03
106 0.03
107 0.02
108 0.02
109 0.02
110 0.02
111 0.03
112 0.04
113 0.07
114 0.08
115 0.1
116 0.11
117 0.12
118 0.14
119 0.15
120 0.16
121 0.15
122 0.15
123 0.13
124 0.12
125 0.11
126 0.08
127 0.07
128 0.05
129 0.03
130 0.03
131 0.03
132 0.03
133 0.04
134 0.04
135 0.05
136 0.05
137 0.05
138 0.06
139 0.06
140 0.07
141 0.06
142 0.07
143 0.08
144 0.08
145 0.09
146 0.1
147 0.12
148 0.11
149 0.12
150 0.14
151 0.15
152 0.15
153 0.19
154 0.18
155 0.17
156 0.18
157 0.16
158 0.14
159 0.13
160 0.12
161 0.1
162 0.1
163 0.09
164 0.08
165 0.08
166 0.07
167 0.07
168 0.07
169 0.06
170 0.06
171 0.06
172 0.05
173 0.05
174 0.05
175 0.05
176 0.05
177 0.04
178 0.05
179 0.05
180 0.06
181 0.08
182 0.08
183 0.09
184 0.1
185 0.1
186 0.1
187 0.12
188 0.11
189 0.11
190 0.12
191 0.11
192 0.11
193 0.1
194 0.1
195 0.08
196 0.08
197 0.06
198 0.05
199 0.06
200 0.06
201 0.07
202 0.12
203 0.12
204 0.15
205 0.18
206 0.22
207 0.3
208 0.37
209 0.44
210 0.49
211 0.57
212 0.61
213 0.63
214 0.63
215 0.58
216 0.58
217 0.51
218 0.44
219 0.37
220 0.32
221 0.26
222 0.22
223 0.19
224 0.11
225 0.1
226 0.07
227 0.05
228 0.05
229 0.05
230 0.05
231 0.04
232 0.05
233 0.05
234 0.05
235 0.06
236 0.06
237 0.07
238 0.09
239 0.09
240 0.11
241 0.12
242 0.15
243 0.15
244 0.16
245 0.22
246 0.21
247 0.24
248 0.22
249 0.23
250 0.21
251 0.2
252 0.24
253 0.19
254 0.22
255 0.2
256 0.2
257 0.18
258 0.21
259 0.23
260 0.25
261 0.3
262 0.31
263 0.37
264 0.42
265 0.45
266 0.45
267 0.46
268 0.49
269 0.51
270 0.5