Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8GTK6

Protein Details
Accession A0A1B8GTK6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
14-36TRLPPLPKLRVKRPNQNNNNPCLHydrophilic
NLS Segment(s)
PositionSequence
97-97R
Subcellular Location(s) mito 23.5, mito_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MPPKKVAVPKAVATRLPPLPKLRVKRPNQNNNNPCLGIMTSVLTCWASSGYSVAGCSALETSLRVCMDTPRSKDLKKNTINYHLSRMYPQIVGPRKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.43
4 0.41
5 0.38
6 0.43
7 0.49
8 0.54
9 0.59
10 0.63
11 0.66
12 0.73
13 0.79
14 0.82
15 0.84
16 0.87
17 0.83
18 0.77
19 0.74
20 0.63
21 0.52
22 0.42
23 0.32
24 0.21
25 0.16
26 0.12
27 0.08
28 0.08
29 0.08
30 0.07
31 0.06
32 0.05
33 0.05
34 0.04
35 0.04
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.04
43 0.05
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.08
50 0.08
51 0.08
52 0.09
53 0.12
54 0.2
55 0.26
56 0.3
57 0.33
58 0.38
59 0.4
60 0.47
61 0.52
62 0.55
63 0.56
64 0.61
65 0.61
66 0.66
67 0.71
68 0.67
69 0.65
70 0.58
71 0.52
72 0.46
73 0.43
74 0.36
75 0.3
76 0.29
77 0.31
78 0.37