Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8GIT5

Protein Details
Accession A0A1B8GIT5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-75SSPDQPYTTLRNKKPRRDKKHydrophilic
NLS Segment(s)
PositionSequence
67-75NKKPRRDKK
Subcellular Location(s) nucl 16, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MSSATTTGAVHGGDSQYISAEPYISITAYGIMVANTKTTKDEQLEMREAELQKWLSSPDQPYTTLRNKKPRRDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.08
5 0.08
6 0.07
7 0.07
8 0.06
9 0.07
10 0.07
11 0.07
12 0.07
13 0.06
14 0.06
15 0.06
16 0.06
17 0.05
18 0.04
19 0.05
20 0.05
21 0.06
22 0.06
23 0.07
24 0.08
25 0.09
26 0.11
27 0.12
28 0.15
29 0.18
30 0.22
31 0.25
32 0.24
33 0.24
34 0.25
35 0.24
36 0.22
37 0.22
38 0.18
39 0.15
40 0.16
41 0.17
42 0.14
43 0.18
44 0.21
45 0.22
46 0.24
47 0.26
48 0.28
49 0.34
50 0.42
51 0.48
52 0.53
53 0.59
54 0.67
55 0.75