Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8G9X4

Protein Details
Accession A0A1B8G9X4    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
352-376AEMEEERRQKRRKIEEEQKRKEDELAcidic
NLS Segment(s)
PositionSequence
359-366RQKRRKIE
Subcellular Location(s) cyto 12, cysk 11, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR047260  ERCC1-like_central_dom  
IPR004579  ERCC1/RAD10/SWI10  
IPR011335  Restrct_endonuc-II-like  
IPR010994  RuvA_2-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0003684  F:damaged DNA binding  
GO:0004519  F:endonuclease activity  
GO:0006310  P:DNA recombination  
GO:0006302  P:double-strand break repair  
Pfam View protein in Pfam  
PF03834  Rad10  
CDD cd22325  ERCC1_C-like  
Amino Acid Sequences MADDDDEFGADPDFLAALAASDNPPPTTRITQPTPQRLDPPPPTTTTTPSSTKIVQPTPQALPSRSSGSAIYVSHRQKGNPMLSHLRAQPWEWRDTPADYVLGNTTCALFLSLKYHRLHPEYVYNRIRGLGGKYALRVLLTLVDIPNHEESVKELSKTGLVNNVTVILCWSAAEGARYLELYKGFEHASAAGIMGVQAKGYAEQFVEFVTVPRGVNRTDAVGIVGAFGSVRAAVNARPEEVAVLSGWGEKKVRRWTEVVREPFRVVKAGKRGMGDGEERGEDERRGEAVEAVPVRDMDQYTRPKSPGMSRESETAQDKGKEKEKETQSQPKKPFQLLELDSDSGGEEALIAAEMEEERRQKRRKIEEEQKRKEDELSGGVAAALAKLRKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.04
5 0.05
6 0.06
7 0.07
8 0.09
9 0.11
10 0.12
11 0.14
12 0.15
13 0.2
14 0.25
15 0.29
16 0.35
17 0.4
18 0.47
19 0.56
20 0.64
21 0.66
22 0.63
23 0.64
24 0.62
25 0.65
26 0.65
27 0.61
28 0.54
29 0.51
30 0.53
31 0.49
32 0.49
33 0.44
34 0.41
35 0.39
36 0.39
37 0.4
38 0.37
39 0.39
40 0.41
41 0.41
42 0.41
43 0.42
44 0.44
45 0.43
46 0.47
47 0.46
48 0.4
49 0.38
50 0.37
51 0.37
52 0.32
53 0.3
54 0.24
55 0.22
56 0.24
57 0.22
58 0.22
59 0.26
60 0.28
61 0.33
62 0.34
63 0.32
64 0.34
65 0.41
66 0.45
67 0.4
68 0.44
69 0.45
70 0.46
71 0.5
72 0.47
73 0.43
74 0.37
75 0.35
76 0.37
77 0.34
78 0.36
79 0.33
80 0.34
81 0.32
82 0.33
83 0.33
84 0.27
85 0.24
86 0.19
87 0.19
88 0.17
89 0.15
90 0.13
91 0.11
92 0.1
93 0.09
94 0.09
95 0.09
96 0.07
97 0.08
98 0.13
99 0.16
100 0.22
101 0.23
102 0.27
103 0.31
104 0.34
105 0.35
106 0.32
107 0.39
108 0.37
109 0.45
110 0.45
111 0.41
112 0.38
113 0.36
114 0.34
115 0.26
116 0.25
117 0.21
118 0.19
119 0.2
120 0.2
121 0.2
122 0.19
123 0.17
124 0.14
125 0.09
126 0.08
127 0.08
128 0.08
129 0.07
130 0.08
131 0.08
132 0.1
133 0.11
134 0.1
135 0.09
136 0.08
137 0.09
138 0.16
139 0.16
140 0.14
141 0.14
142 0.14
143 0.16
144 0.17
145 0.16
146 0.15
147 0.15
148 0.15
149 0.14
150 0.16
151 0.14
152 0.13
153 0.13
154 0.07
155 0.07
156 0.06
157 0.06
158 0.04
159 0.05
160 0.05
161 0.05
162 0.05
163 0.05
164 0.06
165 0.06
166 0.07
167 0.07
168 0.08
169 0.08
170 0.09
171 0.09
172 0.09
173 0.09
174 0.08
175 0.08
176 0.07
177 0.07
178 0.05
179 0.04
180 0.04
181 0.05
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.05
188 0.05
189 0.04
190 0.05
191 0.05
192 0.05
193 0.06
194 0.06
195 0.06
196 0.07
197 0.08
198 0.08
199 0.09
200 0.11
201 0.1
202 0.11
203 0.11
204 0.11
205 0.1
206 0.11
207 0.09
208 0.08
209 0.08
210 0.07
211 0.06
212 0.04
213 0.04
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.04
220 0.05
221 0.1
222 0.11
223 0.11
224 0.11
225 0.11
226 0.12
227 0.11
228 0.11
229 0.06
230 0.06
231 0.05
232 0.07
233 0.08
234 0.09
235 0.1
236 0.11
237 0.18
238 0.27
239 0.3
240 0.31
241 0.35
242 0.4
243 0.49
244 0.57
245 0.59
246 0.54
247 0.53
248 0.52
249 0.5
250 0.44
251 0.38
252 0.3
253 0.28
254 0.32
255 0.35
256 0.36
257 0.34
258 0.34
259 0.31
260 0.33
261 0.28
262 0.21
263 0.18
264 0.16
265 0.15
266 0.16
267 0.17
268 0.14
269 0.13
270 0.13
271 0.12
272 0.12
273 0.12
274 0.12
275 0.11
276 0.15
277 0.15
278 0.14
279 0.14
280 0.13
281 0.14
282 0.14
283 0.14
284 0.12
285 0.2
286 0.28
287 0.31
288 0.36
289 0.36
290 0.35
291 0.38
292 0.43
293 0.44
294 0.42
295 0.43
296 0.41
297 0.44
298 0.44
299 0.46
300 0.41
301 0.35
302 0.33
303 0.33
304 0.34
305 0.37
306 0.43
307 0.44
308 0.44
309 0.51
310 0.54
311 0.58
312 0.63
313 0.68
314 0.7
315 0.74
316 0.78
317 0.77
318 0.76
319 0.71
320 0.65
321 0.56
322 0.56
323 0.49
324 0.48
325 0.43
326 0.37
327 0.33
328 0.3
329 0.28
330 0.18
331 0.15
332 0.09
333 0.05
334 0.04
335 0.04
336 0.04
337 0.03
338 0.03
339 0.04
340 0.05
341 0.07
342 0.11
343 0.17
344 0.22
345 0.31
346 0.38
347 0.45
348 0.55
349 0.64
350 0.7
351 0.76
352 0.82
353 0.84
354 0.89
355 0.92
356 0.9
357 0.84
358 0.76
359 0.67
360 0.61
361 0.53
362 0.46
363 0.39
364 0.31
365 0.26
366 0.24
367 0.21
368 0.17
369 0.13
370 0.12