Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7YI87

Protein Details
Accession C7YI87   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
18-44ATDGIDKARRLRRKRKAETQDNERLSKHydrophilic
NLS Segment(s)
PositionSequence
24-33KARRLRRKRK
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR046591  DUF6649  
KEGG nhe:NECHADRAFT_75232  -  
Pfam View protein in Pfam  
PF20354  DUF6649  
Amino Acid Sequences MLHGAQSPSTSTSAAPVATDGIDKARRLRRKRKAETQDNERLSKRLSLLNIEQSGSKLYVPVEEPSIPTPSIPNATPSSSSSAPDPLVSNDSMQLDDSKHKVYIYNIDDELSSDSESDDPGKLVFLSDIEKHLRVNRIPPAVLANSDGELAGMQLVLYSDPKSLTVPEDKDSVRKAIIESRHRAREQQRLEREGKTNTPRVDRDSTNDTITPQTYTDDDPDAMDVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.12
4 0.11
5 0.11
6 0.12
7 0.1
8 0.14
9 0.17
10 0.18
11 0.26
12 0.34
13 0.43
14 0.53
15 0.63
16 0.68
17 0.76
18 0.85
19 0.88
20 0.9
21 0.91
22 0.91
23 0.89
24 0.89
25 0.83
26 0.78
27 0.68
28 0.59
29 0.5
30 0.44
31 0.37
32 0.31
33 0.27
34 0.28
35 0.3
36 0.36
37 0.35
38 0.32
39 0.3
40 0.26
41 0.26
42 0.21
43 0.17
44 0.11
45 0.1
46 0.11
47 0.13
48 0.13
49 0.14
50 0.14
51 0.16
52 0.16
53 0.18
54 0.16
55 0.14
56 0.14
57 0.13
58 0.15
59 0.14
60 0.16
61 0.16
62 0.17
63 0.18
64 0.19
65 0.22
66 0.2
67 0.21
68 0.18
69 0.18
70 0.17
71 0.16
72 0.16
73 0.12
74 0.13
75 0.13
76 0.12
77 0.12
78 0.12
79 0.11
80 0.11
81 0.1
82 0.09
83 0.11
84 0.13
85 0.13
86 0.13
87 0.12
88 0.13
89 0.14
90 0.2
91 0.2
92 0.21
93 0.2
94 0.2
95 0.19
96 0.19
97 0.19
98 0.11
99 0.09
100 0.06
101 0.07
102 0.06
103 0.07
104 0.07
105 0.06
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.07
114 0.07
115 0.1
116 0.11
117 0.12
118 0.13
119 0.16
120 0.2
121 0.19
122 0.23
123 0.26
124 0.27
125 0.26
126 0.26
127 0.26
128 0.23
129 0.22
130 0.19
131 0.14
132 0.11
133 0.11
134 0.11
135 0.07
136 0.06
137 0.06
138 0.04
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.05
145 0.05
146 0.06
147 0.07
148 0.08
149 0.08
150 0.09
151 0.12
152 0.17
153 0.19
154 0.2
155 0.24
156 0.24
157 0.27
158 0.29
159 0.28
160 0.22
161 0.21
162 0.21
163 0.24
164 0.32
165 0.36
166 0.41
167 0.47
168 0.54
169 0.54
170 0.6
171 0.6
172 0.62
173 0.63
174 0.66
175 0.66
176 0.65
177 0.68
178 0.66
179 0.64
180 0.6
181 0.59
182 0.56
183 0.55
184 0.53
185 0.57
186 0.55
187 0.56
188 0.57
189 0.51
190 0.49
191 0.48
192 0.46
193 0.43
194 0.41
195 0.36
196 0.33
197 0.32
198 0.27
199 0.21
200 0.21
201 0.19
202 0.21
203 0.22
204 0.21
205 0.2
206 0.19