Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P2SWG0

Protein Details
Accession A0A2P2SWG0   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
55-80RTYAAEQKQKFRKKVRVKPTTQCFCIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
Amino Acid Sequences MCKQVAIRYKGCNCVIVNRRKCAIAKQQTFEAGHSIWCKGGVRNLEEFARCERCRTYAAEQKQKFRKKVRVKPTTQCFCI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.54
4 0.56
5 0.53
6 0.53
7 0.51
8 0.51
9 0.49
10 0.51
11 0.51
12 0.5
13 0.49
14 0.49
15 0.5
16 0.5
17 0.42
18 0.34
19 0.23
20 0.19
21 0.17
22 0.16
23 0.11
24 0.12
25 0.12
26 0.1
27 0.13
28 0.13
29 0.15
30 0.16
31 0.18
32 0.19
33 0.19
34 0.2
35 0.21
36 0.26
37 0.24
38 0.25
39 0.24
40 0.25
41 0.27
42 0.3
43 0.34
44 0.35
45 0.45
46 0.53
47 0.56
48 0.63
49 0.71
50 0.75
51 0.75
52 0.76
53 0.77
54 0.78
55 0.84
56 0.86
57 0.86
58 0.86
59 0.88
60 0.89