Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8GJE8

Protein Details
Accession A0A1B8GJE8   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-36SARQQLYYKHYDRKVRKRQRGSRLVVPPPKPHydrophilic
NLS Segment(s)
PositionSequence
19-30KVRKRQRGSRLV
Subcellular Location(s) nucl 12, mito 10, cyto_nucl 9.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MRSMKSARQQLYYKHYDRKVRKRQRGSRLVVPPPKPLLKLQPLLKRPLKEMLSTPPQATTPAKQSPVISSGASASISVNSSSSGPQAQDGEMPLPTAVQVARQLWQFHGCTEEQHQEREEEHTQAHEQPSSLQHACCSLPQVTTLLAGTNIDGSPLNAVPDVLCQHRLIKRGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.66
3 0.69
4 0.74
5 0.78
6 0.81
7 0.83
8 0.87
9 0.89
10 0.92
11 0.93
12 0.93
13 0.88
14 0.87
15 0.85
16 0.84
17 0.81
18 0.74
19 0.69
20 0.64
21 0.6
22 0.52
23 0.46
24 0.45
25 0.44
26 0.48
27 0.5
28 0.53
29 0.54
30 0.6
31 0.62
32 0.55
33 0.51
34 0.52
35 0.46
36 0.39
37 0.38
38 0.37
39 0.38
40 0.38
41 0.36
42 0.29
43 0.27
44 0.28
45 0.27
46 0.22
47 0.22
48 0.24
49 0.26
50 0.26
51 0.26
52 0.25
53 0.25
54 0.24
55 0.18
56 0.14
57 0.12
58 0.12
59 0.11
60 0.09
61 0.07
62 0.06
63 0.07
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.07
70 0.07
71 0.07
72 0.07
73 0.08
74 0.07
75 0.08
76 0.08
77 0.08
78 0.07
79 0.07
80 0.06
81 0.05
82 0.05
83 0.05
84 0.04
85 0.05
86 0.07
87 0.08
88 0.1
89 0.12
90 0.13
91 0.14
92 0.17
93 0.17
94 0.15
95 0.17
96 0.15
97 0.15
98 0.18
99 0.25
100 0.22
101 0.24
102 0.24
103 0.23
104 0.24
105 0.28
106 0.26
107 0.2
108 0.19
109 0.2
110 0.21
111 0.23
112 0.24
113 0.19
114 0.17
115 0.18
116 0.2
117 0.24
118 0.24
119 0.2
120 0.19
121 0.2
122 0.21
123 0.2
124 0.21
125 0.16
126 0.15
127 0.15
128 0.16
129 0.14
130 0.14
131 0.13
132 0.1
133 0.09
134 0.09
135 0.08
136 0.09
137 0.08
138 0.08
139 0.08
140 0.08
141 0.1
142 0.11
143 0.12
144 0.1
145 0.1
146 0.09
147 0.13
148 0.16
149 0.16
150 0.18
151 0.18
152 0.25
153 0.29