Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7Z9A0

Protein Details
Accession C7Z9A0   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
134-162GDADKEAVKNRKPKKKAKKIKLSFDEDEGBasic
NLS Segment(s)
PositionSequence
101-118AAIGGRKRKVGKVIGEAA
120-154EPADKETDGKKDKKGDADKEAVKNRKPKKKAKKIK
Subcellular Location(s) cyto 14, cyto_nucl 11.333, cyto_mito 9.833, nucl 7.5, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
KEGG nhe:NECHADRAFT_81680  -  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MPPKITSKNLSYDNSAPPFLAALRAQAAGATGPDPLLAAQRRSAKKRSSSEEAEDVPLVVDEDGNVVNLEVDKDGIVKEPADHPLDPSTEKEPAKETESKAAIGGRKRKVGKVIGEAAEEPADKETDGKKDKKGDADKEAVKNRKPKKKAKKIKLSFDEDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.43
3 0.36
4 0.3
5 0.27
6 0.22
7 0.21
8 0.14
9 0.12
10 0.13
11 0.14
12 0.13
13 0.12
14 0.12
15 0.09
16 0.09
17 0.07
18 0.06
19 0.05
20 0.05
21 0.06
22 0.05
23 0.11
24 0.13
25 0.14
26 0.19
27 0.27
28 0.34
29 0.39
30 0.46
31 0.47
32 0.54
33 0.6
34 0.62
35 0.61
36 0.59
37 0.59
38 0.56
39 0.51
40 0.43
41 0.36
42 0.28
43 0.21
44 0.16
45 0.12
46 0.07
47 0.05
48 0.03
49 0.04
50 0.04
51 0.05
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.06
64 0.05
65 0.06
66 0.07
67 0.1
68 0.13
69 0.12
70 0.13
71 0.14
72 0.15
73 0.15
74 0.16
75 0.15
76 0.18
77 0.19
78 0.18
79 0.19
80 0.2
81 0.24
82 0.26
83 0.25
84 0.26
85 0.27
86 0.27
87 0.25
88 0.26
89 0.25
90 0.27
91 0.34
92 0.31
93 0.37
94 0.39
95 0.41
96 0.44
97 0.46
98 0.44
99 0.43
100 0.45
101 0.39
102 0.38
103 0.36
104 0.31
105 0.26
106 0.21
107 0.16
108 0.11
109 0.1
110 0.08
111 0.11
112 0.13
113 0.2
114 0.27
115 0.31
116 0.36
117 0.43
118 0.47
119 0.55
120 0.6
121 0.59
122 0.59
123 0.63
124 0.64
125 0.65
126 0.7
127 0.68
128 0.65
129 0.68
130 0.71
131 0.74
132 0.76
133 0.79
134 0.81
135 0.85
136 0.9
137 0.92
138 0.93
139 0.92
140 0.94
141 0.93
142 0.9