Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8GW35

Protein Details
Accession A0A1B8GW35    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
130-158AVTPGKDKQAPPQKKKKVKKVKLSFGDDEHydrophilic
NLS Segment(s)
PositionSequence
74-80KGGKKGE
86-117AKPEAVEPERKEEKIAAIGAARKRKVGKVVGA
123-151GKGSDKAAVTPGKDKQAPPQKKKKVKKVK
Subcellular Location(s) nucl 10cyto_nucl 10, mito 9, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSPKITSKSLSYDSALPPFLQRLRAENTGGSTAAPRARRAPNPDADEEDEPVYVDEEGAALDDDELHSLGVTKKGGKKGEQAAEEAKPEAVEPERKEEKIAAIGAARKRKVGKVVGASEEEEGKGSDKAAVTPGKDKQAPPQKKKKVKKVKLSFGDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.27
4 0.25
5 0.27
6 0.26
7 0.27
8 0.25
9 0.26
10 0.31
11 0.34
12 0.34
13 0.3
14 0.3
15 0.27
16 0.26
17 0.21
18 0.16
19 0.16
20 0.19
21 0.2
22 0.19
23 0.24
24 0.3
25 0.36
26 0.42
27 0.46
28 0.49
29 0.53
30 0.53
31 0.51
32 0.48
33 0.44
34 0.37
35 0.31
36 0.23
37 0.18
38 0.16
39 0.12
40 0.08
41 0.07
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.04
53 0.03
54 0.03
55 0.04
56 0.05
57 0.07
58 0.08
59 0.11
60 0.14
61 0.2
62 0.22
63 0.23
64 0.27
65 0.32
66 0.36
67 0.34
68 0.32
69 0.3
70 0.29
71 0.28
72 0.23
73 0.16
74 0.11
75 0.1
76 0.09
77 0.09
78 0.13
79 0.14
80 0.21
81 0.24
82 0.25
83 0.26
84 0.25
85 0.24
86 0.22
87 0.21
88 0.14
89 0.13
90 0.17
91 0.21
92 0.27
93 0.26
94 0.26
95 0.28
96 0.3
97 0.34
98 0.35
99 0.36
100 0.37
101 0.4
102 0.4
103 0.4
104 0.38
105 0.33
106 0.29
107 0.22
108 0.16
109 0.12
110 0.11
111 0.09
112 0.09
113 0.11
114 0.1
115 0.11
116 0.15
117 0.18
118 0.19
119 0.24
120 0.28
121 0.32
122 0.35
123 0.36
124 0.41
125 0.49
126 0.58
127 0.62
128 0.7
129 0.74
130 0.81
131 0.91
132 0.92
133 0.92
134 0.92
135 0.93
136 0.93
137 0.93
138 0.92