Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2P2SYA2

Protein Details
Accession A0A2P2SYA2   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKLMKKLLKKLMRKLMKKLMKKLINHydrophilic
NLS Segment(s)
PositionSequence
5-22KKLLKKLMRKLMKKLMKK
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037318  Hex1_S1  
IPR001884  IF5A-like  
IPR012340  NA-bd_OB-fold  
IPR014722  Rib_L2_dom2  
IPR020189  Transl_elong_IF5A_C  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0043022  F:ribosome binding  
GO:0003723  F:RNA binding  
GO:0003746  F:translation elongation factor activity  
GO:0045901  P:positive regulation of translational elongation  
GO:0045905  P:positive regulation of translational termination  
Pfam View protein in Pfam  
PF01287  eIF-5a  
CDD cd04469  S1_Hex1  
Amino Acid Sequences MKLMKKLLKKLMRKLMKKLMKKLINELMRKLMKELMKKAGNLDFDARVPIPFSIFPSTYRNVAAAPTKVEETHVEGEIQLPAPQQSSAGRDGYQSSFTASLPPQEQEQRTEEKVHINVKEDRHHRPSLFRRPIQEHSTTHIDVQLPQRHQEQSQQFQPQFQQSQFQQPLNQYHSDNNLNSTIDIAERQYRTRYQPNFQERVSIESNVQPSKVIINDNMGYYDESGHYHSFRNGLHRAADRIVNGSHHHHNPEIDVEITSTTSGGSSQAPRSQSVQGGGIPNTITIPTNHVRIGDIVILQGRASQVIKITTSPATGQHRFLGVDLFTKQLHEDSSFISSPSPSVVVQTVLGPVLKQYRVLDLNDGTVVAMTETGDVKQSLPVIDQSNLWARLNDAFESGRGSVRVLVLNDHGRELAVDMKVIHGSRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.83
4 0.83
5 0.83
6 0.83
7 0.8
8 0.76
9 0.76
10 0.74
11 0.73
12 0.68
13 0.62
14 0.61
15 0.58
16 0.55
17 0.48
18 0.45
19 0.42
20 0.46
21 0.48
22 0.48
23 0.49
24 0.49
25 0.51
26 0.5
27 0.47
28 0.41
29 0.39
30 0.32
31 0.28
32 0.31
33 0.26
34 0.21
35 0.2
36 0.18
37 0.17
38 0.16
39 0.19
40 0.2
41 0.21
42 0.23
43 0.28
44 0.29
45 0.29
46 0.29
47 0.26
48 0.21
49 0.23
50 0.25
51 0.21
52 0.22
53 0.22
54 0.22
55 0.22
56 0.23
57 0.21
58 0.22
59 0.23
60 0.21
61 0.19
62 0.18
63 0.19
64 0.19
65 0.18
66 0.13
67 0.11
68 0.11
69 0.12
70 0.12
71 0.12
72 0.12
73 0.15
74 0.17
75 0.18
76 0.18
77 0.18
78 0.21
79 0.22
80 0.22
81 0.18
82 0.17
83 0.16
84 0.16
85 0.19
86 0.16
87 0.19
88 0.19
89 0.19
90 0.21
91 0.27
92 0.28
93 0.28
94 0.32
95 0.33
96 0.33
97 0.36
98 0.33
99 0.32
100 0.35
101 0.37
102 0.35
103 0.35
104 0.38
105 0.39
106 0.46
107 0.45
108 0.49
109 0.49
110 0.52
111 0.49
112 0.53
113 0.59
114 0.62
115 0.66
116 0.62
117 0.63
118 0.64
119 0.69
120 0.64
121 0.6
122 0.5
123 0.46
124 0.48
125 0.42
126 0.36
127 0.33
128 0.28
129 0.26
130 0.32
131 0.33
132 0.29
133 0.31
134 0.34
135 0.33
136 0.33
137 0.38
138 0.37
139 0.36
140 0.42
141 0.47
142 0.44
143 0.44
144 0.46
145 0.43
146 0.39
147 0.34
148 0.33
149 0.26
150 0.36
151 0.37
152 0.35
153 0.33
154 0.33
155 0.38
156 0.36
157 0.37
158 0.28
159 0.26
160 0.3
161 0.31
162 0.27
163 0.24
164 0.22
165 0.2
166 0.18
167 0.17
168 0.13
169 0.09
170 0.09
171 0.08
172 0.12
173 0.12
174 0.14
175 0.16
176 0.19
177 0.24
178 0.33
179 0.36
180 0.36
181 0.45
182 0.52
183 0.53
184 0.5
185 0.51
186 0.42
187 0.43
188 0.4
189 0.31
190 0.23
191 0.22
192 0.25
193 0.19
194 0.19
195 0.14
196 0.12
197 0.12
198 0.13
199 0.11
200 0.08
201 0.11
202 0.12
203 0.12
204 0.12
205 0.11
206 0.1
207 0.09
208 0.1
209 0.07
210 0.07
211 0.09
212 0.1
213 0.1
214 0.11
215 0.12
216 0.13
217 0.14
218 0.19
219 0.19
220 0.19
221 0.21
222 0.22
223 0.23
224 0.22
225 0.23
226 0.17
227 0.17
228 0.17
229 0.15
230 0.15
231 0.18
232 0.21
233 0.21
234 0.23
235 0.22
236 0.22
237 0.21
238 0.2
239 0.17
240 0.13
241 0.11
242 0.1
243 0.09
244 0.09
245 0.08
246 0.06
247 0.05
248 0.04
249 0.04
250 0.05
251 0.07
252 0.09
253 0.12
254 0.16
255 0.17
256 0.18
257 0.21
258 0.22
259 0.22
260 0.21
261 0.2
262 0.18
263 0.2
264 0.19
265 0.17
266 0.14
267 0.13
268 0.12
269 0.11
270 0.09
271 0.07
272 0.13
273 0.13
274 0.15
275 0.16
276 0.16
277 0.16
278 0.16
279 0.17
280 0.13
281 0.11
282 0.1
283 0.1
284 0.1
285 0.09
286 0.1
287 0.08
288 0.08
289 0.08
290 0.08
291 0.1
292 0.11
293 0.12
294 0.12
295 0.14
296 0.13
297 0.14
298 0.14
299 0.19
300 0.25
301 0.26
302 0.28
303 0.27
304 0.27
305 0.27
306 0.26
307 0.23
308 0.15
309 0.16
310 0.15
311 0.15
312 0.14
313 0.14
314 0.14
315 0.13
316 0.14
317 0.13
318 0.13
319 0.13
320 0.18
321 0.18
322 0.17
323 0.17
324 0.15
325 0.14
326 0.14
327 0.14
328 0.09
329 0.1
330 0.11
331 0.11
332 0.12
333 0.12
334 0.12
335 0.11
336 0.11
337 0.09
338 0.1
339 0.15
340 0.15
341 0.17
342 0.17
343 0.23
344 0.26
345 0.27
346 0.29
347 0.25
348 0.26
349 0.24
350 0.23
351 0.16
352 0.13
353 0.12
354 0.07
355 0.06
356 0.05
357 0.06
358 0.07
359 0.07
360 0.09
361 0.09
362 0.1
363 0.12
364 0.13
365 0.13
366 0.14
367 0.18
368 0.19
369 0.2
370 0.2
371 0.21
372 0.27
373 0.3
374 0.29
375 0.25
376 0.23
377 0.27
378 0.29
379 0.26
380 0.21
381 0.19
382 0.19
383 0.22
384 0.22
385 0.19
386 0.17
387 0.18
388 0.17
389 0.19
390 0.22
391 0.19
392 0.21
393 0.24
394 0.3
395 0.3
396 0.29
397 0.26
398 0.22
399 0.22
400 0.21
401 0.2
402 0.15
403 0.15
404 0.14
405 0.16
406 0.2