Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C7ZJ66

Protein Details
Accession C7ZJ66   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-58HGARSHAMREHWRQRRHKKDLAKRQREHRPQHVLLBasic
NLS Segment(s)
PositionSequence
33-51EHWRQRRHKKDLAKRQREH
Subcellular Location(s) nucl 13, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021858  Fun_TF  
KEGG nhe:NECHADRAFT_49662  -  
Pfam View protein in Pfam  
PF11951  Fungal_trans_2  
Amino Acid Sequences MTPPNPQKPSPPQKEYAFVTPHQHGARSHAMREHWRQRRHKKDLAKRQREHRPQHVLLPTPSTSEAADSQPSTETTDTGPESTVLAGGGMFDPAMFETDMDSMMNGVPGQAMSGMNLALGSARLDPFDQFPVLLTTQHHKLLHHWLSTYATMMFDDVHSQAFNPMRDVWCPLDLSNAASFNAIMAHSAAHLARMQGLRQSKEALKFKAEAVRIVQVWMDDPQRALSDDVLAAVLRLLTYEVWQRLKIFHLGTDVLFYRDIGEPRRSGTSITMASQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.67
3 0.64
4 0.57
5 0.51
6 0.5
7 0.45
8 0.48
9 0.42
10 0.41
11 0.34
12 0.36
13 0.43
14 0.39
15 0.4
16 0.38
17 0.41
18 0.46
19 0.56
20 0.6
21 0.59
22 0.66
23 0.74
24 0.81
25 0.87
26 0.88
27 0.86
28 0.87
29 0.88
30 0.9
31 0.91
32 0.9
33 0.87
34 0.87
35 0.9
36 0.89
37 0.87
38 0.85
39 0.84
40 0.75
41 0.76
42 0.72
43 0.65
44 0.57
45 0.53
46 0.43
47 0.35
48 0.34
49 0.26
50 0.21
51 0.18
52 0.18
53 0.15
54 0.17
55 0.15
56 0.15
57 0.15
58 0.15
59 0.16
60 0.14
61 0.13
62 0.12
63 0.15
64 0.15
65 0.14
66 0.14
67 0.11
68 0.11
69 0.11
70 0.1
71 0.06
72 0.05
73 0.05
74 0.05
75 0.04
76 0.04
77 0.04
78 0.03
79 0.03
80 0.04
81 0.05
82 0.05
83 0.04
84 0.05
85 0.06
86 0.07
87 0.06
88 0.06
89 0.05
90 0.05
91 0.05
92 0.04
93 0.04
94 0.04
95 0.03
96 0.04
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.04
103 0.04
104 0.04
105 0.03
106 0.03
107 0.04
108 0.04
109 0.04
110 0.05
111 0.05
112 0.06
113 0.07
114 0.09
115 0.08
116 0.07
117 0.08
118 0.09
119 0.09
120 0.1
121 0.09
122 0.11
123 0.13
124 0.17
125 0.17
126 0.16
127 0.18
128 0.26
129 0.29
130 0.27
131 0.25
132 0.22
133 0.23
134 0.23
135 0.22
136 0.12
137 0.09
138 0.08
139 0.08
140 0.07
141 0.05
142 0.06
143 0.06
144 0.06
145 0.06
146 0.06
147 0.1
148 0.12
149 0.13
150 0.13
151 0.14
152 0.15
153 0.16
154 0.19
155 0.17
156 0.16
157 0.16
158 0.14
159 0.16
160 0.15
161 0.16
162 0.15
163 0.13
164 0.12
165 0.11
166 0.11
167 0.08
168 0.09
169 0.07
170 0.05
171 0.05
172 0.05
173 0.05
174 0.06
175 0.06
176 0.06
177 0.07
178 0.06
179 0.1
180 0.11
181 0.12
182 0.16
183 0.21
184 0.22
185 0.23
186 0.27
187 0.27
188 0.35
189 0.4
190 0.38
191 0.36
192 0.35
193 0.37
194 0.39
195 0.36
196 0.3
197 0.26
198 0.28
199 0.25
200 0.24
201 0.22
202 0.16
203 0.16
204 0.17
205 0.16
206 0.13
207 0.13
208 0.14
209 0.14
210 0.16
211 0.15
212 0.13
213 0.12
214 0.12
215 0.12
216 0.11
217 0.09
218 0.08
219 0.07
220 0.06
221 0.04
222 0.04
223 0.05
224 0.05
225 0.07
226 0.13
227 0.18
228 0.21
229 0.23
230 0.24
231 0.25
232 0.28
233 0.31
234 0.26
235 0.23
236 0.24
237 0.24
238 0.23
239 0.25
240 0.23
241 0.2
242 0.19
243 0.17
244 0.16
245 0.19
246 0.22
247 0.23
248 0.28
249 0.27
250 0.3
251 0.35
252 0.33
253 0.3
254 0.31
255 0.33
256 0.3