Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B8G643

Protein Details
Accession A0A1B8G643    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MSSNKASRKKSPTRKGSSRSPAPKDKVHydrophilic
NLS Segment(s)
PositionSequence
6-24ASRKKSPTRKGSSRSPAPK
Subcellular Location(s) mito 11, plas 6, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000462  CDP-OH_P_trans  
IPR043130  CDP-OH_PTrfase_TM_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0016780  F:phosphotransferase activity, for other substituted phosphate groups  
GO:0008654  P:phospholipid biosynthetic process  
Pfam View protein in Pfam  
PF01066  CDP-OH_P_transf  
PROSITE View protein in PROSITE  
PS00379  CDP_ALCOHOL_P_TRANSF  
Amino Acid Sequences MSSNKASRKKSPTRKGSSRSPAPKDKVSAEQPLLNGTGAAAAGSKEEHPYENIFLFWPNIIGYVRIVLALGSLYYMPLHPRTCTILYSVSCLLDALDGYAARYFSQSTRFGAVLDMVTDRCTTACLLVFLASAFPRWSIVFQGLISLDLASHYMHMYATLVMGGSGESHKKVDRSRSYILNLYYTNKTVLFLFCALNEIFFIALYLLSFPPPPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.87
3 0.87
4 0.87
5 0.86
6 0.85
7 0.83
8 0.82
9 0.78
10 0.77
11 0.71
12 0.65
13 0.62
14 0.57
15 0.56
16 0.49
17 0.46
18 0.4
19 0.38
20 0.35
21 0.26
22 0.21
23 0.13
24 0.11
25 0.08
26 0.07
27 0.05
28 0.04
29 0.05
30 0.06
31 0.07
32 0.08
33 0.09
34 0.11
35 0.12
36 0.15
37 0.17
38 0.16
39 0.16
40 0.15
41 0.14
42 0.14
43 0.12
44 0.1
45 0.08
46 0.09
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.07
53 0.07
54 0.05
55 0.05
56 0.04
57 0.04
58 0.03
59 0.03
60 0.04
61 0.04
62 0.04
63 0.06
64 0.1
65 0.11
66 0.11
67 0.13
68 0.17
69 0.18
70 0.18
71 0.18
72 0.19
73 0.18
74 0.21
75 0.2
76 0.16
77 0.15
78 0.14
79 0.12
80 0.07
81 0.07
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.05
88 0.05
89 0.06
90 0.06
91 0.07
92 0.11
93 0.12
94 0.13
95 0.15
96 0.15
97 0.14
98 0.14
99 0.13
100 0.09
101 0.08
102 0.08
103 0.06
104 0.06
105 0.06
106 0.06
107 0.05
108 0.06
109 0.06
110 0.06
111 0.07
112 0.06
113 0.07
114 0.07
115 0.07
116 0.06
117 0.07
118 0.06
119 0.06
120 0.06
121 0.06
122 0.07
123 0.07
124 0.08
125 0.08
126 0.09
127 0.1
128 0.09
129 0.11
130 0.1
131 0.1
132 0.09
133 0.08
134 0.06
135 0.05
136 0.06
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.06
144 0.05
145 0.05
146 0.05
147 0.05
148 0.04
149 0.04
150 0.04
151 0.04
152 0.06
153 0.08
154 0.09
155 0.11
156 0.13
157 0.17
158 0.22
159 0.32
160 0.38
161 0.44
162 0.48
163 0.52
164 0.54
165 0.55
166 0.52
167 0.46
168 0.4
169 0.37
170 0.36
171 0.31
172 0.29
173 0.23
174 0.23
175 0.2
176 0.19
177 0.18
178 0.17
179 0.16
180 0.14
181 0.18
182 0.17
183 0.15
184 0.14
185 0.11
186 0.09
187 0.08
188 0.09
189 0.05
190 0.06
191 0.05
192 0.07
193 0.07
194 0.09