Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B8GJJ3

Protein Details
Accession A0A1B8GJJ3   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTLNLKHIKRSRGKSKKKKFTFYEGEDHydrophilic
NLS Segment(s)
PositionSequence
7-19HIKRSRGKSKKKK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.833, mito_nucl 11.166, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR021842  DUF3435  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF11917  DUF3435  
Amino Acid Sequences MTLNLKHIKRSRGKSKKKKFTFYEGEDLSCCVVSFMLALALTNNAFKNKFKSLRDIYNLVVPLDANRITLKWDDEWAERPVFYDVKVTANGVYALTPKERRHIMGNSRDVYKRYYMLDFVDKDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.91
3 0.93
4 0.93
5 0.93
6 0.87
7 0.86
8 0.85
9 0.8
10 0.77
11 0.67
12 0.6
13 0.5
14 0.44
15 0.35
16 0.25
17 0.18
18 0.09
19 0.07
20 0.06
21 0.05
22 0.05
23 0.05
24 0.04
25 0.04
26 0.04
27 0.05
28 0.06
29 0.07
30 0.08
31 0.09
32 0.1
33 0.11
34 0.16
35 0.23
36 0.29
37 0.29
38 0.37
39 0.39
40 0.45
41 0.47
42 0.45
43 0.38
44 0.35
45 0.34
46 0.26
47 0.21
48 0.15
49 0.11
50 0.11
51 0.1
52 0.07
53 0.07
54 0.07
55 0.09
56 0.1
57 0.11
58 0.09
59 0.11
60 0.13
61 0.14
62 0.18
63 0.19
64 0.18
65 0.17
66 0.17
67 0.18
68 0.16
69 0.15
70 0.15
71 0.13
72 0.14
73 0.15
74 0.15
75 0.12
76 0.13
77 0.13
78 0.1
79 0.1
80 0.09
81 0.1
82 0.14
83 0.19
84 0.2
85 0.25
86 0.27
87 0.29
88 0.34
89 0.41
90 0.46
91 0.5
92 0.57
93 0.54
94 0.57
95 0.58
96 0.53
97 0.48
98 0.43
99 0.36
100 0.31
101 0.31
102 0.28
103 0.3
104 0.36