FuNGI

A0A1B7P261

Protein Details

Accession

A0A1B7P261

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
44-68	VVRQLQREKGKGKRKGKGSKEAVAR	Basic

NLS Segment(s)

Position	Sequence
50-68	REKGKGKRKGKGSKEAVAR

Subcellular Location(s)

cyto 10.5, extr 6, cyto_nucl 6, E.R. 5, mito 2, pero 2

Family & Domain DBs

InterPro	View protein in InterPro IPR016005 Erg8 IPR013750 GHMP_kinase_C_dom IPR036554 GHMP_kinase_C_sf IPR006204 GHMP_kinase_N_dom IPR035102 Phosphomevalonate_kinase IPR020568 Ribosomal_S5_D2-typ_fold IPR014721 Ribosomal_S5_D2-typ_fold_subgr
Gene Ontology	GO:0005524 F:ATP binding GO:0004631 F:phosphomevalonate kinase activity GO:0019287 P:isopentenyl diphosphate biosynthetic process, mevalonate pathway GO:0016310 P:phosphorylation GO:0016126 P:sterol biosynthetic process
Pfam	View protein in Pfam PF08544 GHMP_kinases_C PF00288 GHMP_kinases_N

Amino Acid Sequences

MPYHAVSETAVSAPGKVLLTGGYLVLDRQYTGTVFALDARIHVVVRQLQREKGKGKRKGKGSKEAVARALRREEDEVEDGGGGDTMMGEDRAGKAFDGGQGVDDGDGDEEAAAAAADEIIVVKSPQFVDAVWEYGIRREPDGGGVRVVQNGDGPPNPFIETALNYALTYISYVSASKLFGSFSVTILADNDYYSQTTASQVTGSNKGTRFVHFGVKLDEAHKTGLGSSAALVTALVSAIVIHRTIEPGELPMIRDKLHNLAQIAHCAAQGKVGSGFDIAAAVYGSCLYRRFSPTVLDNLGDVGSPQFEERLFSVVEDLNPEQPWDTECADYGIKLPRGMQMVLCDVDCGSQTPGMVKKVLQWRENNREEADALWMELQQNNDKLRLQLKALRHNKANNGNSRTASAVVSTDNNIYNNNNNEEEEDEEDEEDDENVNVNVNKRKDFDAVGKIISRSRALLRTMTAKSGVPIEPKVQTELLDRLSSEVEGVIGGVVPGAGGYDAIALLVRDDAAVVDRLRAFLRTWKSSVEDDFGGKIERVRLLGVAHGSEGLRCEIPAHYYGWMV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.15
2	0.14
3	0.12
4	0.12
5	0.1
6	0.11
7	0.11
8	0.11
9	0.09
10	0.08
11	0.09
12	0.1
13	0.1
14	0.09
15	0.09
16	0.11
17	0.1
18	0.13
19	0.13
20	0.12
21	0.12
22	0.13
23	0.15
24	0.14
25	0.14
26	0.13
27	0.14
28	0.13
29	0.13
30	0.17
31	0.21
32	0.27
33	0.35
34	0.38
35	0.44
36	0.51
37	0.57
38	0.6
39	0.63
40	0.68
41	0.7
42	0.75
43	0.77
44	0.81
45	0.84
46	0.85
47	0.86
48	0.83
49	0.8
50	0.79
51	0.76
52	0.72
53	0.69
54	0.63
55	0.58
56	0.56
57	0.5
58	0.44
59	0.42
60	0.37
61	0.35
62	0.34
63	0.3
64	0.24
65	0.22
66	0.19
67	0.16
68	0.13
69	0.08
70	0.05
71	0.04
72	0.04
73	0.04
74	0.04
75	0.04
76	0.05
77	0.07
78	0.09
79	0.09
80	0.09
81	0.09
82	0.11
83	0.13
84	0.14
85	0.13
86	0.12
87	0.12
88	0.12
89	0.11
90	0.09
91	0.07
92	0.06
93	0.06
94	0.05
95	0.04
96	0.04
97	0.04
98	0.04
99	0.03
100	0.03
101	0.03
102	0.02
103	0.02
104	0.02
105	0.03
106	0.03
107	0.04
108	0.04
109	0.04
110	0.07
111	0.07
112	0.08
113	0.08
114	0.08
115	0.12
116	0.13
117	0.15
118	0.13
119	0.14
120	0.14
121	0.16
122	0.21
123	0.18
124	0.17
125	0.17
126	0.17
127	0.22
128	0.26
129	0.24
130	0.21
131	0.22
132	0.21
133	0.22
134	0.21
135	0.15
136	0.12
137	0.12
138	0.14
139	0.14
140	0.15
141	0.14
142	0.15
143	0.16
144	0.15
145	0.15
146	0.14
147	0.14
148	0.15
149	0.15
150	0.14
151	0.12
152	0.13
153	0.12
154	0.09
155	0.08
156	0.06
157	0.05
158	0.06
159	0.06
160	0.07
161	0.08
162	0.08
163	0.08
164	0.09
165	0.08
166	0.08
167	0.12
168	0.12
169	0.11
170	0.13
171	0.12
172	0.12
173	0.12
174	0.13
175	0.09
176	0.08
177	0.09
178	0.07
179	0.08
180	0.08
181	0.08
182	0.07
183	0.09
184	0.09
185	0.08
186	0.09
187	0.11
188	0.13
189	0.18
190	0.19
191	0.22
192	0.22
193	0.25
194	0.25
195	0.24
196	0.26
197	0.24
198	0.29
199	0.25
200	0.26
201	0.26
202	0.26
203	0.26
204	0.22
205	0.22
206	0.16
207	0.16
208	0.15
209	0.12
210	0.1
211	0.11
212	0.1
213	0.08
214	0.07
215	0.07
216	0.06
217	0.06
218	0.06
219	0.04
220	0.03
221	0.03
222	0.03
223	0.02
224	0.02
225	0.03
226	0.04
227	0.04
228	0.04
229	0.05
230	0.05
231	0.06
232	0.06
233	0.06
234	0.06
235	0.08
236	0.08
237	0.09
238	0.11
239	0.11
240	0.11
241	0.12
242	0.12
243	0.15
244	0.18
245	0.19
246	0.17
247	0.2
248	0.2
249	0.21
250	0.21
251	0.17
252	0.14
253	0.13
254	0.12
255	0.1
256	0.1
257	0.09
258	0.09
259	0.08
260	0.08
261	0.07
262	0.07
263	0.05
264	0.05
265	0.04
266	0.03
267	0.03
268	0.03
269	0.03
270	0.03
271	0.03
272	0.04
273	0.05
274	0.06
275	0.09
276	0.12
277	0.14
278	0.15
279	0.17
280	0.19
281	0.22
282	0.22
283	0.19
284	0.16
285	0.15
286	0.14
287	0.11
288	0.09
289	0.05
290	0.04
291	0.04
292	0.04
293	0.04
294	0.04
295	0.06
296	0.06
297	0.08
298	0.08
299	0.07
300	0.09
301	0.09
302	0.09
303	0.11
304	0.11
305	0.11
306	0.11
307	0.12
308	0.1
309	0.1
310	0.1
311	0.11
312	0.12
313	0.1
314	0.1
315	0.12
316	0.12
317	0.12
318	0.13
319	0.15
320	0.15
321	0.15
322	0.16
323	0.17
324	0.19
325	0.19
326	0.17
327	0.14
328	0.15
329	0.15
330	0.14
331	0.11
332	0.09
333	0.09
334	0.09
335	0.08
336	0.07
337	0.07
338	0.07
339	0.1
340	0.13
341	0.14
342	0.14
343	0.13
344	0.19
345	0.27
346	0.33
347	0.36
348	0.4
349	0.48
350	0.57
351	0.61
352	0.57
353	0.5
354	0.45
355	0.4
356	0.33
357	0.27
358	0.17
359	0.14
360	0.11
361	0.11
362	0.1
363	0.11
364	0.13
365	0.13
366	0.17
367	0.18
368	0.19
369	0.19
370	0.21
371	0.23
372	0.23
373	0.23
374	0.25
375	0.3
376	0.39
377	0.45
378	0.48
379	0.5
380	0.53
381	0.57
382	0.62
383	0.62
384	0.61
385	0.59
386	0.57
387	0.53
388	0.5
389	0.43
390	0.34
391	0.27
392	0.19
393	0.14
394	0.12
395	0.12
396	0.12
397	0.13
398	0.13
399	0.14
400	0.14
401	0.15
402	0.19
403	0.22
404	0.24
405	0.23
406	0.22
407	0.23
408	0.23
409	0.23
410	0.2
411	0.19
412	0.16
413	0.15
414	0.14
415	0.14
416	0.13
417	0.11
418	0.09
419	0.07
420	0.07
421	0.07
422	0.08
423	0.09
424	0.14
425	0.2
426	0.22
427	0.26
428	0.27
429	0.3
430	0.31
431	0.33
432	0.35
433	0.36
434	0.36
435	0.35
436	0.35
437	0.33
438	0.33
439	0.32
440	0.26
441	0.21
442	0.23
443	0.25
444	0.25
445	0.26
446	0.27
447	0.32
448	0.32
449	0.32
450	0.29
451	0.25
452	0.24
453	0.26
454	0.26
455	0.22
456	0.23
457	0.24
458	0.26
459	0.27
460	0.29
461	0.25
462	0.24
463	0.24
464	0.26
465	0.26
466	0.23
467	0.22
468	0.2
469	0.2
470	0.19
471	0.15
472	0.11
473	0.08
474	0.07
475	0.07
476	0.05
477	0.04
478	0.04
479	0.03
480	0.03
481	0.03
482	0.03
483	0.03
484	0.03
485	0.03
486	0.03
487	0.03
488	0.03
489	0.04
490	0.04
491	0.04
492	0.04
493	0.05
494	0.05
495	0.04
496	0.05
497	0.05
498	0.07
499	0.1
500	0.1
501	0.13
502	0.14
503	0.16
504	0.17
505	0.18
506	0.18
507	0.23
508	0.3
509	0.32
510	0.34
511	0.36
512	0.39
513	0.41
514	0.43
515	0.39
516	0.33
517	0.29
518	0.29
519	0.27
520	0.25
521	0.22
522	0.21
523	0.2
524	0.21
525	0.2
526	0.19
527	0.2
528	0.18
529	0.22
530	0.21
531	0.18
532	0.17
533	0.18
534	0.17
535	0.16
536	0.17
537	0.16
538	0.14
539	0.13
540	0.14
541	0.14
542	0.17
543	0.19
544	0.18

A0A1B7P261

3D AlphaFold-predicted Structure Viewer