Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7P3S7

Protein Details
Accession A0A1B7P3S7   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
23-42ADKPLNHTRQPRKRFVGRKTBasic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 15, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016435  DPH1/DPH2  
Gene Ontology GO:0090560  F:2-(3-amino-3-carboxypropyl)histidine synthase activity  
GO:0017183  P:peptidyl-diphthamide biosynthetic process from peptidyl-histidine  
Amino Acid Sequences MSENLSSSTAQLADNNSPPSSTADKPLNHTRQPRKRFVGRKTADAQAQSQKDGDSQPSNTTSLQQARSRRAPRALNQVPAEILDDEDIKAAISLLPRNYSFEIPKTIHRIRTSGAKRVALQFPEASLSSQPLYPTSSPSSAQEWKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.24
4 0.23
5 0.24
6 0.27
7 0.28
8 0.25
9 0.27
10 0.31
11 0.32
12 0.39
13 0.48
14 0.51
15 0.52
16 0.61
17 0.66
18 0.69
19 0.75
20 0.78
21 0.76
22 0.78
23 0.81
24 0.78
25 0.78
26 0.71
27 0.7
28 0.64
29 0.61
30 0.54
31 0.46
32 0.42
33 0.39
34 0.37
35 0.31
36 0.28
37 0.23
38 0.22
39 0.21
40 0.21
41 0.16
42 0.16
43 0.18
44 0.19
45 0.2
46 0.19
47 0.19
48 0.19
49 0.2
50 0.23
51 0.26
52 0.29
53 0.32
54 0.41
55 0.43
56 0.43
57 0.44
58 0.44
59 0.44
60 0.5
61 0.48
62 0.45
63 0.43
64 0.39
65 0.33
66 0.29
67 0.26
68 0.15
69 0.12
70 0.07
71 0.07
72 0.06
73 0.06
74 0.06
75 0.05
76 0.04
77 0.04
78 0.05
79 0.06
80 0.08
81 0.09
82 0.12
83 0.12
84 0.15
85 0.17
86 0.19
87 0.2
88 0.2
89 0.24
90 0.23
91 0.28
92 0.33
93 0.35
94 0.39
95 0.39
96 0.38
97 0.34
98 0.43
99 0.44
100 0.44
101 0.46
102 0.43
103 0.43
104 0.48
105 0.51
106 0.42
107 0.4
108 0.32
109 0.27
110 0.27
111 0.25
112 0.21
113 0.16
114 0.17
115 0.15
116 0.16
117 0.16
118 0.14
119 0.19
120 0.18
121 0.22
122 0.25
123 0.26
124 0.26
125 0.29
126 0.34