Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NJ89

Protein Details
Accession A0A1B7NJ89   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
121-144VQPVTKRRKRSSPEKKRVSPKAKSBasic
NLS Segment(s)
PositionSequence
126-165KRRKRSSPEKKRVSPKAKSADKKLAASKEQNKRARSPKRE
Subcellular Location(s) nucl 16.5, mito_nucl 12.833, mito 8, cyto_mito 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR012308  DNA_ligase_ATP-dep_N  
IPR036599  DNA_ligase_N_sf  
Gene Ontology GO:0005524  F:ATP binding  
GO:0003677  F:DNA binding  
GO:0003910  F:DNA ligase (ATP) activity  
GO:0006310  P:DNA recombination  
GO:0006281  P:DNA repair  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF04675  DNA_ligase_A_N  
Amino Acid Sequences KFFGATAGSASLPKKQSTLAFSSGSGGRKRQEEETRTETNKEILGNGDKDSDMDDVEASREPKVESSHLSSETPSAAGRAESDADTSAEKSHSDNESVSPGSKKLKREKSMGAEESEESDVQPVTKRRKRSSPEKKRVSPKAKSADKKLAASKEQNKRARSPKREIKEVAVDGDKESSSAEQEDLISENDDELGEDKPKLAQKKRETVQQAFKGTRKDPYPDWKAGEPVPYAALCTTFSLIEMTTKRLIILSHCSLFLRQVLRLTPNDLLPTVQLMLNKLAADYAGIELGIGESFIMKAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.3
4 0.32
5 0.37
6 0.35
7 0.33
8 0.32
9 0.35
10 0.36
11 0.36
12 0.33
13 0.31
14 0.31
15 0.34
16 0.37
17 0.42
18 0.48
19 0.48
20 0.52
21 0.55
22 0.59
23 0.58
24 0.57
25 0.5
26 0.42
27 0.39
28 0.32
29 0.26
30 0.22
31 0.25
32 0.24
33 0.23
34 0.23
35 0.2
36 0.2
37 0.2
38 0.17
39 0.11
40 0.1
41 0.09
42 0.08
43 0.1
44 0.13
45 0.12
46 0.12
47 0.13
48 0.13
49 0.15
50 0.18
51 0.19
52 0.2
53 0.25
54 0.28
55 0.29
56 0.29
57 0.27
58 0.25
59 0.23
60 0.2
61 0.14
62 0.11
63 0.09
64 0.08
65 0.09
66 0.09
67 0.1
68 0.09
69 0.1
70 0.1
71 0.1
72 0.11
73 0.11
74 0.11
75 0.1
76 0.1
77 0.1
78 0.14
79 0.15
80 0.16
81 0.16
82 0.16
83 0.18
84 0.18
85 0.19
86 0.16
87 0.16
88 0.22
89 0.26
90 0.32
91 0.39
92 0.49
93 0.52
94 0.56
95 0.61
96 0.61
97 0.65
98 0.6
99 0.51
100 0.43
101 0.39
102 0.35
103 0.29
104 0.21
105 0.13
106 0.11
107 0.09
108 0.08
109 0.12
110 0.15
111 0.25
112 0.29
113 0.37
114 0.41
115 0.5
116 0.57
117 0.64
118 0.71
119 0.72
120 0.78
121 0.81
122 0.84
123 0.84
124 0.87
125 0.85
126 0.79
127 0.76
128 0.75
129 0.74
130 0.7
131 0.67
132 0.65
133 0.59
134 0.57
135 0.52
136 0.46
137 0.41
138 0.44
139 0.47
140 0.47
141 0.54
142 0.57
143 0.55
144 0.58
145 0.65
146 0.67
147 0.66
148 0.67
149 0.66
150 0.65
151 0.7
152 0.64
153 0.58
154 0.55
155 0.48
156 0.41
157 0.33
158 0.28
159 0.22
160 0.21
161 0.16
162 0.1
163 0.1
164 0.07
165 0.07
166 0.07
167 0.07
168 0.06
169 0.06
170 0.07
171 0.08
172 0.08
173 0.08
174 0.07
175 0.07
176 0.07
177 0.06
178 0.06
179 0.06
180 0.07
181 0.07
182 0.07
183 0.08
184 0.11
185 0.15
186 0.23
187 0.29
188 0.37
189 0.44
190 0.54
191 0.57
192 0.62
193 0.65
194 0.64
195 0.67
196 0.65
197 0.64
198 0.58
199 0.58
200 0.55
201 0.5
202 0.48
203 0.42
204 0.39
205 0.38
206 0.44
207 0.48
208 0.47
209 0.49
210 0.45
211 0.45
212 0.42
213 0.4
214 0.31
215 0.25
216 0.22
217 0.18
218 0.17
219 0.14
220 0.14
221 0.1
222 0.11
223 0.11
224 0.09
225 0.09
226 0.09
227 0.09
228 0.14
229 0.14
230 0.17
231 0.18
232 0.18
233 0.17
234 0.18
235 0.18
236 0.16
237 0.23
238 0.24
239 0.24
240 0.25
241 0.25
242 0.25
243 0.26
244 0.27
245 0.22
246 0.19
247 0.21
248 0.23
249 0.27
250 0.29
251 0.31
252 0.29
253 0.28
254 0.29
255 0.26
256 0.23
257 0.19
258 0.19
259 0.17
260 0.16
261 0.15
262 0.15
263 0.17
264 0.18
265 0.17
266 0.15
267 0.13
268 0.12
269 0.11
270 0.1
271 0.08
272 0.07
273 0.07
274 0.06
275 0.06
276 0.07
277 0.06
278 0.05
279 0.04
280 0.04