Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7P2P4

Protein Details
Accession A0A1B7P2P4   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
78-98DDSSMIKKRKQKNGYGSSRLFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR015415  Spast_Vps4_C  
Gene Ontology GO:0005524  F:ATP binding  
GO:0051301  P:cell division  
Pfam View protein in Pfam  
PF09336  Vps4_C  
Amino Acid Sequences MEEDIDAEDPVPELTRAHFEEAMQMARRSVSDVEIRRYEAFAQSMKNSSGSNFFRFPSGEEGNAATGGQSGFGDAGNDDSSMIKKRKQKNGYGSSRLFSFCLVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.14
3 0.16
4 0.19
5 0.19
6 0.18
7 0.23
8 0.24
9 0.27
10 0.24
11 0.22
12 0.19
13 0.18
14 0.19
15 0.16
16 0.15
17 0.14
18 0.18
19 0.21
20 0.26
21 0.27
22 0.29
23 0.27
24 0.28
25 0.25
26 0.2
27 0.19
28 0.15
29 0.16
30 0.15
31 0.16
32 0.16
33 0.16
34 0.14
35 0.13
36 0.18
37 0.19
38 0.2
39 0.2
40 0.19
41 0.2
42 0.2
43 0.2
44 0.2
45 0.19
46 0.16
47 0.15
48 0.16
49 0.15
50 0.15
51 0.13
52 0.07
53 0.06
54 0.06
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.04
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.09
68 0.16
69 0.19
70 0.23
71 0.31
72 0.41
73 0.51
74 0.59
75 0.66
76 0.7
77 0.79
78 0.82
79 0.83
80 0.76
81 0.68
82 0.63
83 0.55
84 0.44