Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NKU1

Protein Details
Accession A0A1B7NKU1   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
8-31RADHLSKTAKKKERKEAQGKSTTNHydrophilic
NLS Segment(s)
PositionSequence
14-77KTAKKKERKEAQGKSTTNKEKARKKNFLMTLGKAKSKAKRSLVETRNVLRAHHDRQKRGGRRGN
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR007949  SDA1_C  
Pfam View protein in Pfam  
PF05285  SDA1  
Amino Acid Sequences MNELKTDRADHLSKTAKKKERKEAQGKSTTNKEKARKKNFLMTLGKAKSKAKRSLVETRNVLRAHHDRQKRGGRRGNNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.59
3 0.61
4 0.69
5 0.76
6 0.79
7 0.8
8 0.83
9 0.85
10 0.84
11 0.84
12 0.85
13 0.78
14 0.72
15 0.71
16 0.67
17 0.63
18 0.62
19 0.61
20 0.61
21 0.7
22 0.74
23 0.73
24 0.7
25 0.71
26 0.66
27 0.66
28 0.6
29 0.52
30 0.51
31 0.46
32 0.44
33 0.38
34 0.39
35 0.38
36 0.42
37 0.46
38 0.44
39 0.48
40 0.53
41 0.61
42 0.61
43 0.62
44 0.6
45 0.55
46 0.56
47 0.5
48 0.44
49 0.41
50 0.43
51 0.43
52 0.47
53 0.51
54 0.5
55 0.59
56 0.7
57 0.72
58 0.75
59 0.76