Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7NM18

Protein Details
Accession A0A1B7NM18    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
145-179ETNTTPRQRGKPGPKKKPRLRKKRRVRWGVGELVDBasic
NLS Segment(s)
PositionSequence
125-140RRRGIPGPKPGSKRGL
149-171TPRQRGKPGPKKKPRLRKKRRVR
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013175  INO80_su_Ies4  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08193  INO80_Ies4  
Amino Acid Sequences MPSSARTPPSSTSSASSLSAGRSSSKPSSKLPNPLVLKLSSSLLSRFPGITPTPEESNNTNVKPKNISSPSSPSSSPSSTSAAASVSAGAGAGAAAAPAITAPASSADNASDAASTPATQSDAQRRRGIPGPKPGSKRGLGQGVETNTTPRQRGKPGPKKKPRLRKKRRVRWGVGELVDEICARY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.26
4 0.21
5 0.2
6 0.2
7 0.17
8 0.18
9 0.18
10 0.23
11 0.29
12 0.33
13 0.35
14 0.38
15 0.48
16 0.51
17 0.59
18 0.57
19 0.58
20 0.56
21 0.56
22 0.54
23 0.44
24 0.4
25 0.31
26 0.29
27 0.21
28 0.19
29 0.17
30 0.16
31 0.16
32 0.16
33 0.15
34 0.14
35 0.16
36 0.15
37 0.17
38 0.19
39 0.21
40 0.22
41 0.22
42 0.25
43 0.23
44 0.28
45 0.3
46 0.28
47 0.3
48 0.3
49 0.31
50 0.32
51 0.31
52 0.34
53 0.34
54 0.35
55 0.33
56 0.37
57 0.37
58 0.37
59 0.36
60 0.29
61 0.29
62 0.28
63 0.25
64 0.21
65 0.21
66 0.19
67 0.19
68 0.17
69 0.13
70 0.12
71 0.1
72 0.08
73 0.05
74 0.04
75 0.04
76 0.03
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.01
83 0.01
84 0.01
85 0.01
86 0.02
87 0.02
88 0.02
89 0.02
90 0.04
91 0.04
92 0.05
93 0.05
94 0.05
95 0.06
96 0.06
97 0.06
98 0.05
99 0.05
100 0.06
101 0.06
102 0.06
103 0.06
104 0.06
105 0.08
106 0.09
107 0.12
108 0.21
109 0.28
110 0.32
111 0.37
112 0.37
113 0.39
114 0.46
115 0.5
116 0.46
117 0.5
118 0.54
119 0.56
120 0.6
121 0.6
122 0.58
123 0.53
124 0.51
125 0.46
126 0.46
127 0.39
128 0.37
129 0.38
130 0.35
131 0.35
132 0.31
133 0.28
134 0.25
135 0.27
136 0.27
137 0.27
138 0.3
139 0.36
140 0.46
141 0.55
142 0.62
143 0.7
144 0.79
145 0.84
146 0.9
147 0.93
148 0.94
149 0.93
150 0.94
151 0.94
152 0.94
153 0.95
154 0.95
155 0.95
156 0.95
157 0.93
158 0.91
159 0.88
160 0.85
161 0.76
162 0.66
163 0.56
164 0.46
165 0.39