Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NMJ5

Protein Details
Accession A0A1B7NMJ5    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-32RSGSSFKGTWRWHRNDKKHKPTTTTGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
CDD cd00024  CD_CSD  
Amino Acid Sequences MPSKWKRSGSSFKGTWRWHRNDKKHKPTTTTGPDNLCKAATDHPLPGQKPPEPEPMDIDGEDGWEVEQILTVQKIYNRLEYWVKWVGYDEDLVWHPAPNFIGSPHLVRHFHDENPTKPGPPLRLPEWLRAWEADDGDLQNTQMMTRWPRGRPSPWEVMSRRPAYHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.72
3 0.71
4 0.72
5 0.73
6 0.8
7 0.83
8 0.85
9 0.9
10 0.91
11 0.9
12 0.88
13 0.84
14 0.8
15 0.79
16 0.77
17 0.73
18 0.67
19 0.63
20 0.59
21 0.55
22 0.49
23 0.39
24 0.29
25 0.24
26 0.24
27 0.23
28 0.22
29 0.22
30 0.26
31 0.31
32 0.32
33 0.34
34 0.34
35 0.32
36 0.34
37 0.37
38 0.41
39 0.38
40 0.39
41 0.38
42 0.36
43 0.35
44 0.3
45 0.27
46 0.17
47 0.14
48 0.13
49 0.09
50 0.06
51 0.04
52 0.05
53 0.04
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.06
60 0.07
61 0.12
62 0.13
63 0.16
64 0.15
65 0.18
66 0.2
67 0.2
68 0.23
69 0.23
70 0.22
71 0.19
72 0.2
73 0.18
74 0.16
75 0.16
76 0.11
77 0.09
78 0.09
79 0.11
80 0.1
81 0.1
82 0.09
83 0.1
84 0.1
85 0.09
86 0.09
87 0.08
88 0.1
89 0.1
90 0.12
91 0.12
92 0.16
93 0.17
94 0.17
95 0.24
96 0.24
97 0.25
98 0.33
99 0.35
100 0.33
101 0.4
102 0.4
103 0.33
104 0.33
105 0.35
106 0.32
107 0.32
108 0.35
109 0.31
110 0.4
111 0.42
112 0.46
113 0.46
114 0.43
115 0.39
116 0.35
117 0.34
118 0.27
119 0.25
120 0.19
121 0.17
122 0.15
123 0.15
124 0.15
125 0.12
126 0.11
127 0.1
128 0.09
129 0.1
130 0.13
131 0.17
132 0.25
133 0.32
134 0.34
135 0.42
136 0.49
137 0.54
138 0.58
139 0.61
140 0.62
141 0.6
142 0.65
143 0.61
144 0.62
145 0.65
146 0.62