Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NV92

Protein Details
Accession A0A1B7NV92   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
177-203QQNPSATKPPQQRPQLPPQRHPRQFSVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR006771  Bys1  
IPR037176  Osmotin/thaumatin-like_sf  
Pfam View protein in Pfam  
PF04681  Bys1  
Amino Acid Sequences MYIKGALAAAAAFSALPSALAGTASVKNNCDCPVYLWSVANLGNVPRHTINPGETYVEEYRTNPNGGGISLKISKNYSDLVITQFEYTLAGPKVFYDVSNINGYPFVDFGVSLASPSGSCPAVHCPPGVKLCKGAYNNPDDIATLACSSSQDLTMILCPTGAQQSQQEITPTATTEQQNPSATKPPQQRPQLPPQRHPRQFSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.05
9 0.08
10 0.12
11 0.17
12 0.19
13 0.2
14 0.21
15 0.23
16 0.24
17 0.24
18 0.2
19 0.2
20 0.23
21 0.25
22 0.26
23 0.24
24 0.23
25 0.23
26 0.22
27 0.19
28 0.16
29 0.13
30 0.15
31 0.14
32 0.18
33 0.17
34 0.17
35 0.18
36 0.2
37 0.21
38 0.2
39 0.21
40 0.19
41 0.18
42 0.23
43 0.22
44 0.23
45 0.21
46 0.2
47 0.23
48 0.23
49 0.24
50 0.18
51 0.18
52 0.16
53 0.15
54 0.15
55 0.1
56 0.11
57 0.15
58 0.15
59 0.15
60 0.16
61 0.16
62 0.16
63 0.17
64 0.14
65 0.11
66 0.12
67 0.12
68 0.13
69 0.13
70 0.12
71 0.11
72 0.1
73 0.09
74 0.08
75 0.1
76 0.09
77 0.08
78 0.08
79 0.08
80 0.1
81 0.1
82 0.1
83 0.09
84 0.09
85 0.12
86 0.13
87 0.13
88 0.12
89 0.12
90 0.12
91 0.09
92 0.08
93 0.06
94 0.04
95 0.04
96 0.04
97 0.05
98 0.05
99 0.05
100 0.05
101 0.04
102 0.04
103 0.05
104 0.07
105 0.06
106 0.06
107 0.07
108 0.13
109 0.15
110 0.16
111 0.16
112 0.16
113 0.19
114 0.26
115 0.28
116 0.23
117 0.24
118 0.25
119 0.31
120 0.31
121 0.34
122 0.32
123 0.34
124 0.34
125 0.31
126 0.3
127 0.24
128 0.22
129 0.17
130 0.13
131 0.08
132 0.07
133 0.07
134 0.07
135 0.08
136 0.08
137 0.08
138 0.07
139 0.07
140 0.08
141 0.1
142 0.1
143 0.09
144 0.08
145 0.08
146 0.09
147 0.13
148 0.12
149 0.12
150 0.13
151 0.17
152 0.19
153 0.2
154 0.2
155 0.18
156 0.2
157 0.19
158 0.18
159 0.15
160 0.2
161 0.2
162 0.24
163 0.26
164 0.3
165 0.33
166 0.33
167 0.36
168 0.4
169 0.4
170 0.43
171 0.49
172 0.53
173 0.59
174 0.67
175 0.72
176 0.71
177 0.81
178 0.83
179 0.81
180 0.81
181 0.83
182 0.84
183 0.83