Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7P2E4

Protein Details
Accession A0A1B7P2E4   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
150-174GEMAEEKRERERKRKESRFPGVDNDBasic
NLS Segment(s)
PositionSequence
156-167KRERERKRKESR
Subcellular Location(s) mito 10, nucl 9, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039383  FHIT  
IPR011146  HIT-like  
IPR036265  HIT-like_sf  
Gene Ontology GO:0047710  F:bis(5'-adenosyl)-triphosphatase activity  
GO:0000166  F:nucleotide binding  
Pfam View protein in Pfam  
PF01230  HIT  
PROSITE View protein in PROSITE  
PS51084  HIT_2  
CDD cd01275  FHIT  
Amino Acid Sequences MSLISKNPIYFGPFLVTPQASLEKKPSLDSTHVFYITPLSFALVNLKPLLPGHVLVCPRRRVPRVTDLSPSETTDLFLTVRRVSRMIERVYHGTSLNIAIQDGPEAGQTVPHVHAHIIPRRKADLDQRGGSDAIYEMMEGREGNIARHLGEMAEEKRERERKRKESRFPGVDNDKREPRSEEEMMEEAYGLAKEMEGEVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.22
4 0.18
5 0.2
6 0.26
7 0.23
8 0.25
9 0.29
10 0.29
11 0.3
12 0.32
13 0.33
14 0.3
15 0.33
16 0.33
17 0.34
18 0.34
19 0.34
20 0.31
21 0.27
22 0.28
23 0.23
24 0.21
25 0.16
26 0.12
27 0.12
28 0.12
29 0.18
30 0.14
31 0.15
32 0.15
33 0.15
34 0.15
35 0.15
36 0.17
37 0.12
38 0.12
39 0.12
40 0.15
41 0.18
42 0.23
43 0.28
44 0.3
45 0.33
46 0.4
47 0.43
48 0.43
49 0.46
50 0.51
51 0.53
52 0.52
53 0.53
54 0.48
55 0.5
56 0.46
57 0.41
58 0.32
59 0.25
60 0.22
61 0.17
62 0.14
63 0.1
64 0.1
65 0.11
66 0.12
67 0.13
68 0.13
69 0.14
70 0.14
71 0.19
72 0.23
73 0.23
74 0.23
75 0.24
76 0.26
77 0.27
78 0.27
79 0.21
80 0.16
81 0.14
82 0.13
83 0.11
84 0.08
85 0.07
86 0.06
87 0.05
88 0.06
89 0.05
90 0.04
91 0.03
92 0.04
93 0.04
94 0.05
95 0.05
96 0.07
97 0.08
98 0.08
99 0.09
100 0.08
101 0.11
102 0.16
103 0.22
104 0.27
105 0.28
106 0.29
107 0.31
108 0.32
109 0.32
110 0.36
111 0.39
112 0.39
113 0.39
114 0.38
115 0.38
116 0.36
117 0.33
118 0.24
119 0.15
120 0.1
121 0.07
122 0.06
123 0.05
124 0.05
125 0.06
126 0.05
127 0.06
128 0.09
129 0.09
130 0.1
131 0.12
132 0.13
133 0.12
134 0.13
135 0.13
136 0.09
137 0.1
138 0.14
139 0.13
140 0.2
141 0.2
142 0.21
143 0.3
144 0.38
145 0.43
146 0.49
147 0.59
148 0.62
149 0.73
150 0.82
151 0.84
152 0.87
153 0.91
154 0.88
155 0.81
156 0.8
157 0.79
158 0.74
159 0.7
160 0.67
161 0.64
162 0.59
163 0.58
164 0.53
165 0.49
166 0.51
167 0.47
168 0.41
169 0.38
170 0.37
171 0.35
172 0.31
173 0.24
174 0.16
175 0.15
176 0.13
177 0.09
178 0.07
179 0.06
180 0.06