Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NQS5

Protein Details
Accession A0A1B7NQS5   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAPRSYSKTYKVPRRPYESARLDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR022801  Ribosomal_S4/S9  
IPR005710  Ribosomal_S4/S9_euk/arc  
IPR001912  Ribosomal_S4/S9_N  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00163  Ribosomal_S4  
Amino Acid Sequences MAPRSYSKTYKVPRRPYESARLDSELEIIGKYGLRNKREVWRVQLTLSKIRRAARELLTLDEKDPKRLFEGNALIRRLVRVGVLDESRMKLDYVLALKVEDFLERRLQTQVYQLGLAKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.79
4 0.8
5 0.77
6 0.71
7 0.64
8 0.58
9 0.5
10 0.43
11 0.37
12 0.28
13 0.21
14 0.16
15 0.11
16 0.09
17 0.08
18 0.09
19 0.15
20 0.2
21 0.22
22 0.25
23 0.28
24 0.36
25 0.42
26 0.45
27 0.45
28 0.46
29 0.45
30 0.44
31 0.45
32 0.4
33 0.41
34 0.4
35 0.36
36 0.33
37 0.35
38 0.35
39 0.34
40 0.35
41 0.29
42 0.32
43 0.3
44 0.29
45 0.28
46 0.26
47 0.24
48 0.27
49 0.24
50 0.24
51 0.24
52 0.22
53 0.22
54 0.24
55 0.24
56 0.22
57 0.28
58 0.3
59 0.35
60 0.35
61 0.32
62 0.3
63 0.3
64 0.25
65 0.18
66 0.12
67 0.08
68 0.09
69 0.12
70 0.12
71 0.14
72 0.15
73 0.16
74 0.16
75 0.16
76 0.14
77 0.11
78 0.11
79 0.13
80 0.14
81 0.14
82 0.13
83 0.13
84 0.13
85 0.14
86 0.14
87 0.12
88 0.12
89 0.13
90 0.2
91 0.21
92 0.22
93 0.24
94 0.25
95 0.24
96 0.3
97 0.32
98 0.26
99 0.27