Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7P745

Protein Details
Accession A0A1B7P745   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
67-86LDTLRRKRIKRLGVKSPMHSHydrophilic
NLS Segment(s)
PositionSequence
72-77RKRIKR
Subcellular Location(s) nucl 13.5, cyto_nucl 12.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003107  HAT  
IPR011990  TPR-like_helical_dom_sf  
IPR013949  Utp6  
Gene Ontology GO:0005634  C:nucleus  
GO:0030515  F:snoRNA binding  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF08640  U3_assoc_6  
Amino Acid Sequences MATASDKARFYLEQLVPEFKEYEKKKIFSKDEIAAILKKRSDFEHRINATGPKPADYARYAEYEMNLDTLRRKRIKRLGVKSPMHSGQRRVFFILDRATKRFHGDISLWMQLIEYARRQKAYKKLGQIFMNVLRLHPTKAELWIYAARYALEDHGDMTQARSYMQRGLRFCKSSKLLWLQYAKLEMIYISRIATRQQILGLVGPRKTPPGASDDPAMDPNADVIALPVVTEEDINPSLGKEDGVDEAALENLNSTPALTGAIPIAIFDAAMRQFGNDTAIGRDFYTMIAEFEKTPCLRRVLGHVVESMMAANRTSADTQICYIMFPVVGIEISSAEFPRAFGTSLSRLKTCTTENPGGHKILAKEVIAWLEPLTSTEGLDPALCKVMTATLRNVEGLLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.37
4 0.39
5 0.37
6 0.28
7 0.35
8 0.32
9 0.4
10 0.43
11 0.45
12 0.5
13 0.59
14 0.64
15 0.62
16 0.66
17 0.6
18 0.56
19 0.56
20 0.52
21 0.47
22 0.45
23 0.42
24 0.38
25 0.34
26 0.32
27 0.34
28 0.4
29 0.42
30 0.46
31 0.52
32 0.51
33 0.52
34 0.53
35 0.54
36 0.47
37 0.46
38 0.39
39 0.3
40 0.3
41 0.28
42 0.3
43 0.26
44 0.28
45 0.24
46 0.26
47 0.25
48 0.25
49 0.25
50 0.22
51 0.2
52 0.19
53 0.16
54 0.15
55 0.2
56 0.24
57 0.32
58 0.38
59 0.41
60 0.49
61 0.59
62 0.68
63 0.72
64 0.75
65 0.77
66 0.79
67 0.82
68 0.75
69 0.73
70 0.69
71 0.66
72 0.6
73 0.56
74 0.53
75 0.54
76 0.52
77 0.47
78 0.43
79 0.36
80 0.37
81 0.38
82 0.38
83 0.35
84 0.36
85 0.36
86 0.36
87 0.39
88 0.36
89 0.29
90 0.25
91 0.23
92 0.26
93 0.27
94 0.28
95 0.24
96 0.22
97 0.21
98 0.19
99 0.2
100 0.16
101 0.17
102 0.21
103 0.23
104 0.26
105 0.27
106 0.33
107 0.41
108 0.48
109 0.5
110 0.53
111 0.58
112 0.62
113 0.63
114 0.58
115 0.53
116 0.47
117 0.45
118 0.35
119 0.28
120 0.27
121 0.26
122 0.24
123 0.2
124 0.19
125 0.15
126 0.18
127 0.19
128 0.15
129 0.17
130 0.19
131 0.2
132 0.18
133 0.18
134 0.14
135 0.13
136 0.14
137 0.11
138 0.09
139 0.08
140 0.08
141 0.08
142 0.09
143 0.08
144 0.08
145 0.09
146 0.08
147 0.09
148 0.09
149 0.1
150 0.16
151 0.2
152 0.24
153 0.25
154 0.31
155 0.35
156 0.37
157 0.37
158 0.37
159 0.36
160 0.32
161 0.36
162 0.38
163 0.35
164 0.37
165 0.39
166 0.33
167 0.31
168 0.32
169 0.25
170 0.18
171 0.15
172 0.1
173 0.08
174 0.08
175 0.07
176 0.06
177 0.06
178 0.07
179 0.08
180 0.11
181 0.11
182 0.1
183 0.1
184 0.11
185 0.1
186 0.12
187 0.14
188 0.14
189 0.14
190 0.14
191 0.14
192 0.14
193 0.14
194 0.13
195 0.11
196 0.16
197 0.17
198 0.18
199 0.19
200 0.19
201 0.2
202 0.2
203 0.19
204 0.12
205 0.1
206 0.08
207 0.07
208 0.05
209 0.04
210 0.04
211 0.04
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.04
218 0.04
219 0.06
220 0.07
221 0.07
222 0.07
223 0.07
224 0.08
225 0.08
226 0.08
227 0.05
228 0.06
229 0.06
230 0.07
231 0.07
232 0.06
233 0.06
234 0.07
235 0.06
236 0.05
237 0.04
238 0.04
239 0.04
240 0.04
241 0.04
242 0.04
243 0.04
244 0.05
245 0.05
246 0.05
247 0.05
248 0.06
249 0.05
250 0.05
251 0.06
252 0.04
253 0.04
254 0.04
255 0.06
256 0.06
257 0.07
258 0.07
259 0.07
260 0.07
261 0.08
262 0.1
263 0.08
264 0.09
265 0.1
266 0.11
267 0.12
268 0.12
269 0.12
270 0.1
271 0.1
272 0.11
273 0.09
274 0.09
275 0.09
276 0.1
277 0.1
278 0.11
279 0.16
280 0.15
281 0.18
282 0.21
283 0.23
284 0.23
285 0.24
286 0.3
287 0.34
288 0.36
289 0.34
290 0.31
291 0.29
292 0.27
293 0.26
294 0.19
295 0.12
296 0.09
297 0.08
298 0.07
299 0.07
300 0.09
301 0.1
302 0.11
303 0.11
304 0.12
305 0.13
306 0.16
307 0.15
308 0.13
309 0.13
310 0.12
311 0.1
312 0.09
313 0.08
314 0.06
315 0.06
316 0.06
317 0.05
318 0.05
319 0.06
320 0.07
321 0.07
322 0.08
323 0.08
324 0.08
325 0.1
326 0.11
327 0.11
328 0.11
329 0.16
330 0.23
331 0.28
332 0.31
333 0.3
334 0.3
335 0.32
336 0.35
337 0.34
338 0.34
339 0.37
340 0.43
341 0.45
342 0.51
343 0.53
344 0.51
345 0.47
346 0.43
347 0.36
348 0.34
349 0.34
350 0.27
351 0.24
352 0.24
353 0.25
354 0.22
355 0.21
356 0.15
357 0.12
358 0.12
359 0.12
360 0.14
361 0.12
362 0.12
363 0.12
364 0.13
365 0.13
366 0.14
367 0.13
368 0.11
369 0.15
370 0.14
371 0.13
372 0.13
373 0.19
374 0.23
375 0.26
376 0.29
377 0.29
378 0.31
379 0.31