Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NWE5

Protein Details
Accession A0A1B7NWE5    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
58-85VFALKKKEDNERKKGDKRRSSKLQTLGFHydrophilic
NLS Segment(s)
PositionSequence
62-77KKKEDNERKKGDKRRS
Subcellular Location(s) cyto 16, cyto_nucl 13.5, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR010920  LSM_dom_sf  
IPR044642  PTHR15588  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
Amino Acid Sequences NLVLQGTVERLYAGNTFADIQRGIYLVRGENVLLLGEVDLDTEDDIPPGYRQAPFEEVFALKKKEDNERKKGDKRRSSKLQTLGFEAEHSGEVLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.11
5 0.13
6 0.11
7 0.11
8 0.1
9 0.11
10 0.1
11 0.11
12 0.12
13 0.1
14 0.11
15 0.1
16 0.1
17 0.09
18 0.09
19 0.07
20 0.06
21 0.05
22 0.04
23 0.04
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.05
35 0.05
36 0.06
37 0.07
38 0.08
39 0.1
40 0.14
41 0.14
42 0.15
43 0.16
44 0.15
45 0.16
46 0.19
47 0.19
48 0.15
49 0.17
50 0.2
51 0.29
52 0.39
53 0.46
54 0.52
55 0.59
56 0.69
57 0.76
58 0.83
59 0.83
60 0.83
61 0.81
62 0.82
63 0.83
64 0.82
65 0.81
66 0.8
67 0.77
68 0.69
69 0.67
70 0.59
71 0.49
72 0.41
73 0.34
74 0.26
75 0.19