Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NKA2

Protein Details
Accession A0A1B7NKA2    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
55-74QKKPGAPSTSKKSKKKGGDEBasic
NLS Segment(s)
PositionSequence
56-72KKPGAPSTSKKSKKKGG
Subcellular Location(s) cyto 13, cyto_nucl 11.833, nucl 9.5, cyto_mito 8.333
Family & Domain DBs
Amino Acid Sequences LEVTARNLKGVTIKDALDAIHKQFKKKADDELDNPILAGFEWDKEESWTRLIVHQKKPGAPSTSKKSKKKGGDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.21
4 0.2
5 0.2
6 0.19
7 0.25
8 0.26
9 0.28
10 0.32
11 0.38
12 0.4
13 0.4
14 0.45
15 0.44
16 0.48
17 0.48
18 0.51
19 0.46
20 0.39
21 0.36
22 0.28
23 0.2
24 0.15
25 0.13
26 0.05
27 0.05
28 0.06
29 0.07
30 0.07
31 0.09
32 0.12
33 0.12
34 0.13
35 0.14
36 0.14
37 0.19
38 0.28
39 0.34
40 0.39
41 0.45
42 0.49
43 0.51
44 0.54
45 0.55
46 0.52
47 0.5
48 0.51
49 0.54
50 0.6
51 0.67
52 0.71
53 0.74
54 0.77