Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7P670

Protein Details
Accession A0A1B7P670    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
3-23IDYSRRNKKPRLLLEPEKQELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11.833, mito_nucl 10.833, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000789  Cyclin-dep_kinase_reg-sub  
IPR036858  Cyclin-dep_kinase_reg-sub_sf  
Gene Ontology GO:0016538  F:cyclin-dependent protein serine/threonine kinase regulator activity  
GO:0016301  F:kinase activity  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF01111  CKS  
PROSITE View protein in PROSITE  
PS00945  CKS_2  
Amino Acid Sequences MDIDYSRRNKKPRLLLEPEKQELHEFIEAIHYSSRYSDSEFEYRHVQLPKNMLKKIPADYFDTSKGTLKLLWEEEWRGLGITQSLGWEHYEVHEPEPHILLFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.81
4 0.81
5 0.76
6 0.67
7 0.58
8 0.49
9 0.41
10 0.35
11 0.26
12 0.18
13 0.14
14 0.18
15 0.17
16 0.16
17 0.16
18 0.13
19 0.12
20 0.13
21 0.15
22 0.11
23 0.13
24 0.13
25 0.17
26 0.21
27 0.22
28 0.23
29 0.24
30 0.24
31 0.27
32 0.28
33 0.25
34 0.23
35 0.29
36 0.34
37 0.36
38 0.36
39 0.32
40 0.32
41 0.33
42 0.35
43 0.31
44 0.26
45 0.26
46 0.27
47 0.29
48 0.28
49 0.27
50 0.23
51 0.22
52 0.21
53 0.17
54 0.16
55 0.14
56 0.15
57 0.16
58 0.17
59 0.18
60 0.19
61 0.19
62 0.19
63 0.18
64 0.15
65 0.12
66 0.11
67 0.09
68 0.08
69 0.08
70 0.08
71 0.08
72 0.08
73 0.09
74 0.09
75 0.09
76 0.1
77 0.17
78 0.17
79 0.2
80 0.23
81 0.23
82 0.25
83 0.27