Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7NKE7

Protein Details
Accession A0A1B7NKE7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
95-115AGVRWWKSGKGQRKTEKESEMHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, E.R. 4, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences TYATALGTISSFSAVIYFTIPLVMPALSLLPTVNLPNLVYDSIISILWLTLFGIFGKLYITKDAPEGDVDTIRMKHAVWVDLANLALWAATAAWAGVRWWKSGKGQRKTEKESEMGEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.07
5 0.06
6 0.07
7 0.07
8 0.07
9 0.08
10 0.07
11 0.06
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.05
18 0.06
19 0.07
20 0.07
21 0.07
22 0.07
23 0.08
24 0.09
25 0.08
26 0.08
27 0.07
28 0.07
29 0.07
30 0.07
31 0.06
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.03
38 0.03
39 0.03
40 0.04
41 0.04
42 0.04
43 0.05
44 0.06
45 0.06
46 0.08
47 0.08
48 0.08
49 0.09
50 0.09
51 0.09
52 0.09
53 0.1
54 0.09
55 0.09
56 0.09
57 0.1
58 0.1
59 0.1
60 0.1
61 0.09
62 0.11
63 0.12
64 0.13
65 0.12
66 0.12
67 0.12
68 0.13
69 0.13
70 0.09
71 0.07
72 0.06
73 0.05
74 0.04
75 0.04
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.04
82 0.04
83 0.1
84 0.11
85 0.13
86 0.16
87 0.19
88 0.28
89 0.38
90 0.48
91 0.52
92 0.62
93 0.7
94 0.77
95 0.82
96 0.81
97 0.77
98 0.71