Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2JTI2

Protein Details
Accession I2JTI2    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-35DYTVKYVNSNWRKKRKIQDNYGLPIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9.166, cyto_mito 6.666, cyto 6.5, mito 5.5, cyto_pero 5.166
Family & Domain DBs
Amino Acid Sequences MGFEIPGIGYDYTVKYVNSNWRKKRKIQXDNYGLPIVAPTVTXQPYSYCPLIPSTEVYDFNMLYTDDWNIRLGMDEGRDCDLRARXNSVFGXFNXYDMNXPEDVITTTAGNENNKSLGFKXSSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.18
4 0.28
5 0.36
6 0.46
7 0.53
8 0.63
9 0.69
10 0.77
11 0.83
12 0.83
13 0.83
14 0.83
15 0.83
16 0.81
17 0.79
18 0.72
19 0.61
20 0.5
21 0.39
22 0.3
23 0.19
24 0.11
25 0.07
26 0.08
27 0.09
28 0.1
29 0.1
30 0.13
31 0.16
32 0.17
33 0.16
34 0.13
35 0.15
36 0.15
37 0.16
38 0.14
39 0.13
40 0.15
41 0.16
42 0.16
43 0.15
44 0.14
45 0.13
46 0.12
47 0.09
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.08
54 0.07
55 0.07
56 0.08
57 0.08
58 0.08
59 0.09
60 0.09
61 0.1
62 0.12
63 0.13
64 0.12
65 0.16
66 0.2
67 0.2
68 0.24
69 0.25
70 0.25
71 0.26
72 0.29
73 0.26
74 0.23
75 0.24
76 0.21
77 0.2
78 0.19
79 0.19
80 0.16
81 0.16
82 0.14
83 0.11
84 0.11
85 0.1
86 0.1
87 0.09
88 0.09
89 0.12
90 0.15
91 0.16
92 0.17
93 0.18
94 0.19
95 0.2
96 0.21
97 0.19