Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7P6T4

Protein Details
Accession A0A1B7P6T4    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPPCRKFDLPRRPRSRPGSGQKRQFRDPYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008699  NDUFB8  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF05821  NDUF_B8  
Amino Acid Sequences MPPCRKFDLPRRPRSRPGSGQKRQFRDPYGDWWDKQDRRNFGEPVHEDNDILTILSTEKYTHFKPAKGLSPTGVDLEVPNISRKAQTIANFIRSPGNDGSNLPVPVKTEVDPGVWRLGPEGRGTGSLDPRACQRSYSKGNSYKWDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.83
5 0.83
6 0.83
7 0.85
8 0.85
9 0.83
10 0.8
11 0.75
12 0.68
13 0.65
14 0.58
15 0.56
16 0.56
17 0.54
18 0.48
19 0.49
20 0.55
21 0.52
22 0.55
23 0.54
24 0.51
25 0.53
26 0.58
27 0.53
28 0.45
29 0.5
30 0.45
31 0.44
32 0.4
33 0.34
34 0.28
35 0.26
36 0.26
37 0.16
38 0.14
39 0.07
40 0.05
41 0.05
42 0.06
43 0.06
44 0.06
45 0.07
46 0.11
47 0.12
48 0.2
49 0.22
50 0.23
51 0.27
52 0.31
53 0.36
54 0.35
55 0.35
56 0.27
57 0.27
58 0.26
59 0.22
60 0.18
61 0.11
62 0.09
63 0.09
64 0.09
65 0.07
66 0.08
67 0.08
68 0.08
69 0.09
70 0.09
71 0.11
72 0.13
73 0.15
74 0.22
75 0.24
76 0.29
77 0.29
78 0.29
79 0.3
80 0.26
81 0.28
82 0.23
83 0.22
84 0.17
85 0.17
86 0.21
87 0.21
88 0.22
89 0.18
90 0.17
91 0.17
92 0.18
93 0.2
94 0.17
95 0.15
96 0.16
97 0.17
98 0.18
99 0.18
100 0.19
101 0.18
102 0.17
103 0.16
104 0.18
105 0.17
106 0.17
107 0.17
108 0.15
109 0.16
110 0.18
111 0.2
112 0.22
113 0.26
114 0.26
115 0.25
116 0.3
117 0.33
118 0.31
119 0.3
120 0.31
121 0.35
122 0.43
123 0.5
124 0.54
125 0.58
126 0.63