Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2JZ61

Protein Details
Accession I2JZ61    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
67-88LPKPKDYGPKPKRKRGPKGAGFBasic
NLS Segment(s)
PositionSequence
69-150KPKDYGPKPKRKRGPKGAGFGQRGGGRGGRGGRGGFRGGRGGRGGFSRGGGRGXFRGGRGGFSRGGGRGGFRGGRGGFHGRR
Subcellular Location(s) mito 15, nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038664  Gar1/Naf1_Cbf5-bd_sf  
IPR007504  H/ACA_rnp_Gar1/Naf1  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04410  Gar1  
Amino Acid Sequences MKKIPYFNAPIYLENKQEVGKVDEILGPINEVYFTVHPSEGVQASSFKDGDKFYIAGDKLLPLERFLPKPKDYGPKPKRKRGPKGAGFGQRGGGRGGRGGRGGFRGGRGGRGGFSRGGGRGXFRGGRGGFSRGGGRGGFRGGRGGFHGRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.25
4 0.25
5 0.24
6 0.23
7 0.21
8 0.2
9 0.2
10 0.2
11 0.2
12 0.19
13 0.16
14 0.12
15 0.1
16 0.1
17 0.08
18 0.07
19 0.09
20 0.08
21 0.09
22 0.11
23 0.11
24 0.11
25 0.11
26 0.14
27 0.12
28 0.12
29 0.11
30 0.11
31 0.12
32 0.14
33 0.14
34 0.11
35 0.13
36 0.13
37 0.14
38 0.14
39 0.13
40 0.11
41 0.17
42 0.16
43 0.15
44 0.15
45 0.13
46 0.12
47 0.15
48 0.15
49 0.1
50 0.13
51 0.16
52 0.18
53 0.22
54 0.27
55 0.25
56 0.27
57 0.31
58 0.36
59 0.38
60 0.47
61 0.52
62 0.58
63 0.64
64 0.71
65 0.76
66 0.77
67 0.83
68 0.83
69 0.84
70 0.8
71 0.79
72 0.78
73 0.77
74 0.69
75 0.59
76 0.52
77 0.42
78 0.36
79 0.3
80 0.23
81 0.15
82 0.15
83 0.16
84 0.14
85 0.14
86 0.13
87 0.14
88 0.15
89 0.17
90 0.15
91 0.15
92 0.2
93 0.19
94 0.2
95 0.21
96 0.19
97 0.19
98 0.2
99 0.21
100 0.15
101 0.16
102 0.16
103 0.16
104 0.18
105 0.17
106 0.17
107 0.22
108 0.22
109 0.22
110 0.25
111 0.24
112 0.25
113 0.28
114 0.29
115 0.23
116 0.23
117 0.24
118 0.21
119 0.23
120 0.2
121 0.18
122 0.17
123 0.2
124 0.2
125 0.18
126 0.24
127 0.22
128 0.23
129 0.26