Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7NJU6

Protein Details
Accession A0A1B7NJU6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-37ATNGETKLSKKQQKKLKKNNGEAVEIHydrophilic
NLS Segment(s)
PositionSequence
22-29KQQKKLKK
Subcellular Location(s) nucl 11.5, mito_nucl 11.5, mito 10.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MSKALKSGSEPATNGETKLSKKQQKKLKKNNGEAVEIPVKPSDPAKSDKKVQFAKNLEQGPTPSPPKKDGEKKAPATGTLGVKEVQGVTLDDKKLGTGRVAKKGDRVSMRYIGKLENGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.27
4 0.26
5 0.35
6 0.42
7 0.46
8 0.53
9 0.62
10 0.68
11 0.75
12 0.83
13 0.85
14 0.87
15 0.88
16 0.89
17 0.89
18 0.83
19 0.76
20 0.65
21 0.6
22 0.54
23 0.43
24 0.35
25 0.26
26 0.22
27 0.18
28 0.19
29 0.16
30 0.14
31 0.2
32 0.25
33 0.29
34 0.37
35 0.4
36 0.46
37 0.5
38 0.49
39 0.52
40 0.5
41 0.51
42 0.49
43 0.47
44 0.4
45 0.34
46 0.33
47 0.26
48 0.26
49 0.26
50 0.22
51 0.22
52 0.25
53 0.28
54 0.35
55 0.42
56 0.46
57 0.51
58 0.57
59 0.58
60 0.61
61 0.57
62 0.5
63 0.43
64 0.39
65 0.32
66 0.24
67 0.21
68 0.16
69 0.15
70 0.15
71 0.13
72 0.09
73 0.08
74 0.08
75 0.1
76 0.15
77 0.15
78 0.15
79 0.15
80 0.16
81 0.17
82 0.17
83 0.18
84 0.22
85 0.28
86 0.37
87 0.41
88 0.42
89 0.47
90 0.51
91 0.55
92 0.53
93 0.51
94 0.47
95 0.52
96 0.53
97 0.49
98 0.46
99 0.41