Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I2JSS0

Protein Details
Accession I2JSS0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
101-121GQKTRNNAKTARKLNRLDRKRHydrophilic
NLS Segment(s)
PositionSequence
105-121RNNAKTARKLNRLDRKR
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027437  30s_Rbsml_prot_S13_C  
IPR001892  Ribosomal_S13  
IPR010979  Ribosomal_S13-like_H2TH  
IPR018269  Ribosomal_S13_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00416  Ribosomal_S13  
PROSITE View protein in PROSITE  
PS00646  RIBOSOMAL_S13_1  
PS50159  RIBOSOMAL_S13_2  
Amino Acid Sequences MVVHILGKAVKGKARVAYGLAATFYGIGFNTATRICSKLGFYPEMRVHQLTEQQVMSITKELSDMTIESKLLSQIRSNIQLKKDTGSYAGLRHAMGLPVRGQKTRNNAKTARKLNRLDRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.27
4 0.26
5 0.24
6 0.22
7 0.19
8 0.15
9 0.12
10 0.11
11 0.09
12 0.07
13 0.05
14 0.06
15 0.05
16 0.06
17 0.08
18 0.08
19 0.09
20 0.1
21 0.11
22 0.11
23 0.13
24 0.14
25 0.17
26 0.2
27 0.23
28 0.22
29 0.27
30 0.3
31 0.31
32 0.32
33 0.28
34 0.25
35 0.23
36 0.27
37 0.22
38 0.21
39 0.18
40 0.15
41 0.16
42 0.15
43 0.14
44 0.11
45 0.09
46 0.07
47 0.08
48 0.07
49 0.06
50 0.07
51 0.06
52 0.06
53 0.07
54 0.07
55 0.07
56 0.07
57 0.09
58 0.1
59 0.11
60 0.1
61 0.13
62 0.16
63 0.23
64 0.27
65 0.29
66 0.31
67 0.35
68 0.35
69 0.33
70 0.31
71 0.25
72 0.23
73 0.23
74 0.21
75 0.18
76 0.2
77 0.19
78 0.17
79 0.18
80 0.17
81 0.15
82 0.14
83 0.14
84 0.16
85 0.22
86 0.24
87 0.26
88 0.27
89 0.31
90 0.41
91 0.5
92 0.53
93 0.54
94 0.59
95 0.67
96 0.75
97 0.8
98 0.79
99 0.78
100 0.79
101 0.82