Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7P6Y0

Protein Details
Accession A0A1B7P6Y0    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
53-81VEPQEKKKTPKGRAKKRLQHSRRFNNVTMHydrophilic
NLS Segment(s)
PositionSequence
57-74EKKKTPKGRAKKRLQHSR
Subcellular Location(s) mito 22.5, mito_nucl 13, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVSFRLVFFNSQPFLEEKPFSDLVSKKRSSTGMVEPQEKKKTPKGRAKKRLQHSRRFNNVTMTGGKRKNEMEGTNGARAAIRAEETWH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.49
4 0.52
5 0.54
6 0.62
7 0.59
8 0.62
9 0.57
10 0.51
11 0.5
12 0.44
13 0.42
14 0.36
15 0.36
16 0.29
17 0.27
18 0.27
19 0.21
20 0.21
21 0.2
22 0.19
23 0.16
24 0.2
25 0.21
26 0.2
27 0.23
28 0.24
29 0.26
30 0.34
31 0.33
32 0.29
33 0.31
34 0.32
35 0.29
36 0.29
37 0.3
38 0.31
39 0.33
40 0.38
41 0.38
42 0.43
43 0.47
44 0.44
45 0.41
46 0.41
47 0.48
48 0.51
49 0.59
50 0.64
51 0.7
52 0.79
53 0.86
54 0.87
55 0.89
56 0.91
57 0.89
58 0.88
59 0.88
60 0.88
61 0.87
62 0.83
63 0.74
64 0.7
65 0.63
66 0.56
67 0.5
68 0.45
69 0.43
70 0.42
71 0.41
72 0.38
73 0.37
74 0.39
75 0.4
76 0.36
77 0.32
78 0.35
79 0.39
80 0.38
81 0.37
82 0.32
83 0.26
84 0.25
85 0.22
86 0.16
87 0.14