Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I2K452

Protein Details
Accession I2K452    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
116-149WYDQMFYIKPNKRRLNKRIKNKKKRFDAGISNLLHydrophilic
NLS Segment(s)
PositionSequence
126-142KPNKRRLNKRIKNKKKR
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MFRIALKSGCETQXGSRLFVRTVSTKASKDDPLSILSSITGKTKFEHIXNDSHSLFSFLDDSKTKQKASLRARDFARAMPLPAKISGRTTLIRKSSNFNKSISMFDRLVRANNIRDLWYDQMFYIKPNKRRLNKRIKNKKKRFDAGISNLLSIVKDAVRKGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.32
4 0.31
5 0.29
6 0.31
7 0.27
8 0.22
9 0.25
10 0.29
11 0.28
12 0.31
13 0.35
14 0.35
15 0.34
16 0.36
17 0.31
18 0.29
19 0.29
20 0.26
21 0.21
22 0.18
23 0.16
24 0.13
25 0.15
26 0.13
27 0.12
28 0.13
29 0.19
30 0.22
31 0.23
32 0.3
33 0.28
34 0.33
35 0.35
36 0.36
37 0.31
38 0.27
39 0.27
40 0.19
41 0.18
42 0.14
43 0.12
44 0.13
45 0.13
46 0.16
47 0.22
48 0.24
49 0.24
50 0.26
51 0.3
52 0.37
53 0.44
54 0.5
55 0.46
56 0.5
57 0.51
58 0.51
59 0.47
60 0.38
61 0.35
62 0.26
63 0.23
64 0.19
65 0.19
66 0.16
67 0.16
68 0.16
69 0.12
70 0.13
71 0.14
72 0.15
73 0.16
74 0.17
75 0.21
76 0.24
77 0.27
78 0.26
79 0.31
80 0.37
81 0.41
82 0.41
83 0.37
84 0.37
85 0.35
86 0.38
87 0.35
88 0.31
89 0.25
90 0.24
91 0.27
92 0.24
93 0.24
94 0.23
95 0.24
96 0.22
97 0.25
98 0.25
99 0.22
100 0.23
101 0.24
102 0.24
103 0.23
104 0.21
105 0.17
106 0.19
107 0.18
108 0.19
109 0.26
110 0.3
111 0.36
112 0.46
113 0.55
114 0.61
115 0.72
116 0.8
117 0.82
118 0.85
119 0.89
120 0.9
121 0.92
122 0.94
123 0.94
124 0.94
125 0.93
126 0.92
127 0.88
128 0.86
129 0.84
130 0.81
131 0.78
132 0.69
133 0.59
134 0.51
135 0.43
136 0.34
137 0.24
138 0.18
139 0.12
140 0.13