Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1B7P0L9

Protein Details
Accession A0A1B7P0L9    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
21-42LVLLKERTRRRGSQRVRDQWIFHydrophilic
145-177DSTKKAKKLTASELRKKRKDRMARRKRGEEVDSBasic
NLS Segment(s)
PositionSequence
148-171KKAKKLTASELRKKRKDRMARRKR
Subcellular Location(s) nucl 8, cyto 6, mito_nucl 6, mito 4, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0003746  F:translation elongation factor activity  
Amino Acid Sequences MTILRNRTMISSEGIVYVGVLVLLKERTRRRGSQRVRDQWIFDIGVLNSWSRQEGTPTNYLDRDSLGALSKALKSFEGGVIIITHSSEFTEGLTTEQWAMHPGPDGIGRMSPSGHNWVQGQGSGPRLTEKDDEEDKFDAMGNKIDSTKKAKKLTASELRKKRKDRMARRKRGEEVDSDFDDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.12
4 0.1
5 0.07
6 0.05
7 0.04
8 0.04
9 0.06
10 0.08
11 0.1
12 0.18
13 0.23
14 0.32
15 0.38
16 0.47
17 0.54
18 0.63
19 0.72
20 0.75
21 0.81
22 0.82
23 0.84
24 0.79
25 0.72
26 0.63
27 0.57
28 0.46
29 0.35
30 0.29
31 0.2
32 0.19
33 0.17
34 0.15
35 0.11
36 0.11
37 0.12
38 0.1
39 0.11
40 0.12
41 0.16
42 0.2
43 0.25
44 0.26
45 0.28
46 0.27
47 0.28
48 0.24
49 0.21
50 0.17
51 0.12
52 0.11
53 0.1
54 0.09
55 0.09
56 0.1
57 0.11
58 0.11
59 0.11
60 0.1
61 0.09
62 0.1
63 0.1
64 0.1
65 0.08
66 0.08
67 0.07
68 0.07
69 0.07
70 0.05
71 0.05
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.06
84 0.06
85 0.07
86 0.07
87 0.07
88 0.08
89 0.07
90 0.08
91 0.08
92 0.09
93 0.08
94 0.08
95 0.09
96 0.08
97 0.09
98 0.09
99 0.1
100 0.15
101 0.15
102 0.15
103 0.15
104 0.17
105 0.17
106 0.16
107 0.17
108 0.13
109 0.16
110 0.15
111 0.15
112 0.15
113 0.15
114 0.18
115 0.18
116 0.18
117 0.21
118 0.25
119 0.26
120 0.27
121 0.28
122 0.25
123 0.23
124 0.22
125 0.19
126 0.15
127 0.18
128 0.16
129 0.16
130 0.19
131 0.2
132 0.23
133 0.29
134 0.36
135 0.41
136 0.47
137 0.49
138 0.53
139 0.58
140 0.65
141 0.66
142 0.68
143 0.7
144 0.74
145 0.81
146 0.83
147 0.83
148 0.83
149 0.82
150 0.83
151 0.84
152 0.86
153 0.86
154 0.89
155 0.92
156 0.92
157 0.89
158 0.86
159 0.79
160 0.75
161 0.71
162 0.67