Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1B7P423

Protein Details
Accession A0A1B7P423    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
30-49TDESYKRQTKRTSNSFPAQYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_nucl 10, nucl 8.5, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007855  RNA-dep_RNA_pol_euk-typ  
Gene Ontology GO:0003723  F:RNA binding  
GO:0003968  F:RNA-dependent RNA polymerase activity  
GO:0031047  P:RNA-mediated gene silencing  
Pfam View protein in Pfam  
PF05183  RdRP  
Amino Acid Sequences MATFYDDFLKTLLFSNGPACRSWLQMNRITDESYKRQTKRTSNSFPAQYAEQAVLLLDAGFLPLKLPYLTKIFRHLLQDYLDNLKNLKVTVSQSTFAYCIADPYGVLKPDEVHLGFSREWEHGAVGTELHDIDVLVARLPAHLATDIQKRRSVYKNELRHFKDVIVFPTTGDTPLASLLSGGDYDGDQCWVCWDPIIVREFKNTEFDHEAIPSPEDLGLRPCWTPMSKIGSTEKFLANAFMFNVKPSKLGQCTNEHETFCYHENNIASKIAVRLAWLLSYLVDSKKAGLELTEEAWEHLKPKYTKVFTEKEPFLPAYKSLSRGSRPPVWNSFNMVDYLLFDVIVAESEQMIVRFDKFCEEHSGLPIDPDLVAIWDNVEQQAIKEKQENKPDLYNALHNLRKQVREKKAEWDEFNGPTSRTPYARKIVDAAQKLEEIHPPPDFDHPLGHTWRNSSYEWERLRASCAYKDCRSDFVWYATGPALCEIKARAIGHFRMVDGEIHSFMHVSRNAAKKVMDQISWHVADEGSDPENEDGELSDINE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.21
3 0.25
4 0.26
5 0.25
6 0.27
7 0.26
8 0.3
9 0.37
10 0.38
11 0.4
12 0.46
13 0.49
14 0.49
15 0.5
16 0.49
17 0.46
18 0.45
19 0.46
20 0.48
21 0.54
22 0.53
23 0.59
24 0.65
25 0.71
26 0.74
27 0.76
28 0.77
29 0.76
30 0.81
31 0.78
32 0.7
33 0.64
34 0.55
35 0.46
36 0.38
37 0.3
38 0.22
39 0.17
40 0.15
41 0.11
42 0.09
43 0.07
44 0.05
45 0.04
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.07
52 0.08
53 0.09
54 0.11
55 0.19
56 0.23
57 0.25
58 0.32
59 0.34
60 0.37
61 0.42
62 0.4
63 0.37
64 0.35
65 0.37
66 0.32
67 0.35
68 0.33
69 0.28
70 0.27
71 0.25
72 0.24
73 0.21
74 0.19
75 0.17
76 0.18
77 0.25
78 0.27
79 0.27
80 0.26
81 0.27
82 0.26
83 0.23
84 0.22
85 0.14
86 0.12
87 0.12
88 0.12
89 0.1
90 0.13
91 0.17
92 0.16
93 0.16
94 0.15
95 0.15
96 0.16
97 0.21
98 0.18
99 0.17
100 0.17
101 0.21
102 0.21
103 0.21
104 0.22
105 0.18
106 0.18
107 0.16
108 0.14
109 0.11
110 0.13
111 0.12
112 0.1
113 0.1
114 0.1
115 0.09
116 0.09
117 0.08
118 0.06
119 0.06
120 0.08
121 0.07
122 0.07
123 0.07
124 0.07
125 0.07
126 0.08
127 0.07
128 0.06
129 0.07
130 0.08
131 0.12
132 0.21
133 0.26
134 0.28
135 0.32
136 0.32
137 0.38
138 0.45
139 0.47
140 0.48
141 0.53
142 0.61
143 0.65
144 0.73
145 0.71
146 0.67
147 0.61
148 0.52
149 0.49
150 0.41
151 0.37
152 0.31
153 0.26
154 0.22
155 0.23
156 0.22
157 0.16
158 0.14
159 0.11
160 0.07
161 0.08
162 0.08
163 0.06
164 0.05
165 0.05
166 0.05
167 0.05
168 0.04
169 0.04
170 0.04
171 0.05
172 0.05
173 0.06
174 0.06
175 0.06
176 0.08
177 0.08
178 0.08
179 0.08
180 0.08
181 0.08
182 0.13
183 0.16
184 0.16
185 0.15
186 0.19
187 0.2
188 0.21
189 0.25
190 0.21
191 0.23
192 0.24
193 0.25
194 0.22
195 0.22
196 0.22
197 0.17
198 0.17
199 0.13
200 0.1
201 0.1
202 0.09
203 0.08
204 0.1
205 0.11
206 0.12
207 0.12
208 0.11
209 0.12
210 0.13
211 0.15
212 0.17
213 0.23
214 0.22
215 0.25
216 0.3
217 0.3
218 0.31
219 0.32
220 0.27
221 0.21
222 0.2
223 0.19
224 0.14
225 0.12
226 0.11
227 0.11
228 0.1
229 0.1
230 0.12
231 0.1
232 0.11
233 0.12
234 0.16
235 0.17
236 0.2
237 0.22
238 0.27
239 0.31
240 0.36
241 0.38
242 0.33
243 0.31
244 0.29
245 0.28
246 0.23
247 0.2
248 0.15
249 0.14
250 0.15
251 0.16
252 0.16
253 0.14
254 0.12
255 0.11
256 0.12
257 0.1
258 0.09
259 0.08
260 0.07
261 0.07
262 0.07
263 0.07
264 0.06
265 0.05
266 0.06
267 0.07
268 0.06
269 0.07
270 0.07
271 0.08
272 0.08
273 0.08
274 0.07
275 0.06
276 0.08
277 0.08
278 0.09
279 0.09
280 0.09
281 0.09
282 0.1
283 0.1
284 0.1
285 0.1
286 0.16
287 0.15
288 0.2
289 0.28
290 0.29
291 0.33
292 0.38
293 0.41
294 0.39
295 0.46
296 0.44
297 0.37
298 0.38
299 0.35
300 0.3
301 0.26
302 0.22
303 0.2
304 0.2
305 0.22
306 0.22
307 0.25
308 0.25
309 0.28
310 0.33
311 0.36
312 0.37
313 0.39
314 0.44
315 0.43
316 0.43
317 0.43
318 0.39
319 0.31
320 0.28
321 0.24
322 0.16
323 0.13
324 0.13
325 0.09
326 0.07
327 0.06
328 0.06
329 0.05
330 0.06
331 0.05
332 0.04
333 0.04
334 0.04
335 0.05
336 0.05
337 0.06
338 0.06
339 0.08
340 0.09
341 0.09
342 0.13
343 0.13
344 0.15
345 0.21
346 0.23
347 0.23
348 0.24
349 0.26
350 0.22
351 0.21
352 0.19
353 0.13
354 0.1
355 0.09
356 0.07
357 0.05
358 0.06
359 0.05
360 0.06
361 0.06
362 0.07
363 0.07
364 0.07
365 0.07
366 0.07
367 0.16
368 0.17
369 0.18
370 0.24
371 0.3
372 0.36
373 0.46
374 0.5
375 0.44
376 0.48
377 0.47
378 0.45
379 0.41
380 0.38
381 0.33
382 0.36
383 0.35
384 0.31
385 0.38
386 0.39
387 0.44
388 0.49
389 0.54
390 0.57
391 0.62
392 0.63
393 0.66
394 0.7
395 0.71
396 0.64
397 0.6
398 0.55
399 0.49
400 0.5
401 0.41
402 0.32
403 0.27
404 0.27
405 0.25
406 0.23
407 0.27
408 0.3
409 0.36
410 0.38
411 0.37
412 0.37
413 0.41
414 0.46
415 0.45
416 0.41
417 0.35
418 0.35
419 0.35
420 0.33
421 0.31
422 0.26
423 0.25
424 0.23
425 0.23
426 0.23
427 0.27
428 0.29
429 0.24
430 0.25
431 0.24
432 0.28
433 0.32
434 0.34
435 0.3
436 0.3
437 0.33
438 0.33
439 0.31
440 0.34
441 0.33
442 0.39
443 0.4
444 0.4
445 0.4
446 0.37
447 0.4
448 0.38
449 0.37
450 0.34
451 0.39
452 0.43
453 0.45
454 0.51
455 0.49
456 0.49
457 0.47
458 0.46
459 0.42
460 0.39
461 0.37
462 0.3
463 0.3
464 0.28
465 0.27
466 0.21
467 0.2
468 0.17
469 0.14
470 0.16
471 0.15
472 0.16
473 0.21
474 0.21
475 0.23
476 0.28
477 0.3
478 0.34
479 0.34
480 0.31
481 0.28
482 0.28
483 0.26
484 0.22
485 0.23
486 0.18
487 0.17
488 0.17
489 0.15
490 0.14
491 0.19
492 0.18
493 0.2
494 0.26
495 0.33
496 0.35
497 0.38
498 0.39
499 0.37
500 0.44
501 0.46
502 0.4
503 0.35
504 0.39
505 0.44
506 0.43
507 0.39
508 0.31
509 0.25
510 0.24
511 0.23
512 0.21
513 0.14
514 0.14
515 0.15
516 0.15
517 0.15
518 0.14
519 0.13
520 0.1
521 0.1